SecReT6
Protein ID: 325298230
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1086
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1237547..1238056 [+]
Producthypothetical protein
NoteTssO
UniProt IDF0R5G7
KEGG IDbsa:Bacsa_1086
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|325298230|ref|YP_004258147.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MNDNKKTLNKRETLMGHIYVFLFFFVTTVVCCLAIFMWNSDFKMFEEKEFVKIKMDRIKDFQQEQADSQQ
AIDSLFRKIETFEPGVHAQYEEDDIHYLINNLRNTYERNSWDKRYKLFMHIADFYAMWLADKKQLWSIEQ
NIQLFKANLEECEIGLQKKEEDLRSGTKK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1237547-1238056 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAATGACAATAAAAAAACACTGAACAAGCGGGAGACCCTGATGGGGCATATTTATGTATTCCTGTTCT
TTTTCGTAACAACCGTGGTATGTTGCCTGGCAATATTCATGTGGAATTCGGATTTCAAGATGTTTGAAGA
GAAGGAGTTCGTGAAAATAAAAATGGACCGCATTAAAGATTTCCAACAGGAACAAGCCGACAGCCAACAG
GCCATAGATTCCCTGTTCCGTAAAATCGAGACCTTCGAACCAGGGGTACATGCCCAATATGAAGAAGACG
ATATCCACTACCTGATAAACAACCTGCGCAACACATACGAAAGAAACAGCTGGGACAAACGGTACAAGCT
GTTTATGCACATAGCCGACTTTTACGCCATGTGGTTGGCAGACAAAAAACAATTGTGGAGTATCGAACAA
AACATACAACTGTTCAAAGCCAATCTGGAAGAATGCGAGATCGGATTGCAGAAAAAAGAAGAAGACTTGC
GTTCAGGCACTAAAAAATGA