SecReT6
Protein ID: 325298231
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1087
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1238062..1238967 [+]
ProductPKD domain-containing protein
NoteTssP
UniProt IDF0R5G8
KEGG IDbsa:Bacsa_1087
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 1.10E-14, Aligned region: 44..95
PKD [PF00801], Evalue: 1.10E-14, Aligned region: 124..178
PKD [PF00801], Evalue: 1.10E-14, Aligned region: 240..248
phage_tail_N [PF08400], Evalue: 0.0073, Aligned region: 70..117
phage_tail_N [PF08400], Evalue: 0.0073, Aligned region: 166..181
Protein Sequence: 301 a.a.     [Download]
>gi|325298231|ref|YP_004258148.1| PKD domain-containing protein [Bacteroides salanitronis DSM 18170]
MGKIYTRKILFVAAAMLLCILIAVLIRIFFSSRTVRMTLTPIEVEVGEPIYYADSTRRANSWLWEFGNGD
VSHERNGQYVFKEPGRYQVRLQVDHSLEKKQIITVRKKTNTYGSDQLVKMKAPASAFQGEIVSFKGYGPS
KEWRWQFGESGIVDSREQNPLYAYSEPGEYEVLLTTEDTQYPVRHTIKILSQYTENDSTDVLVIIGNDIR
EHLQAIVDGRPFNTHYNYILKKYLCGNPDIAVTVNNHKKNDFYSYCQGLKIIARKKTVIDEVFVDMGDDL
NNECVMQLMVTQHERFSESKK
 
Nucleotide Sequence: 906 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1238062-1238967 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGGAAAGATTTATACCAGAAAGATTCTGTTTGTAGCGGCAGCCATGCTGCTGTGCATACTTATTGCCG
TGCTGATCCGGATATTTTTCTCCAGCCGGACCGTGCGGATGACACTGACCCCCATAGAAGTGGAGGTCGG
AGAACCTATCTATTATGCGGACAGTACCCGCAGGGCAAACTCATGGCTCTGGGAGTTCGGCAACGGGGAT
GTATCACACGAACGAAACGGGCAATATGTGTTCAAAGAACCGGGGCGTTACCAGGTACGCCTGCAAGTGG
ACCATTCGCTGGAAAAGAAGCAGATTATCACCGTACGGAAGAAAACAAACACTTACGGGAGCGATCAGCT
TGTAAAAATGAAAGCTCCGGCAAGCGCTTTCCAAGGTGAAATCGTGTCTTTCAAAGGATACGGCCCCTCG
AAAGAGTGGCGGTGGCAATTCGGCGAGTCAGGAATCGTTGATTCCCGAGAACAAAATCCGCTCTATGCCT
ATTCGGAACCAGGCGAATATGAAGTGCTGCTGACTACGGAAGACACACAATACCCCGTACGGCACACGAT
TAAAATCCTTTCCCAGTACACAGAAAACGACTCTACGGACGTGCTTGTCATTATCGGGAACGATATCCGA
GAACATTTGCAGGCCATCGTGGACGGCAGACCGTTCAATACCCATTATAACTATATCCTGAAGAAATATC
TCTGTGGAAATCCGGACATAGCCGTCACAGTCAACAACCATAAAAAGAATGACTTCTATTCTTACTGCCA
GGGGCTGAAAATCATTGCGCGAAAGAAAACCGTGATTGATGAAGTGTTTGTCGATATGGGCGATGACCTG
AACAACGAATGCGTCATGCAGCTGATGGTGACCCAACACGAACGTTTTTCCGAATCAAAAAAGTAA