SecReT6
Protein ID: 325298233
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1089
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1241488..1242528 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R5H0
KEGG IDbsa:Bacsa_1089
PDB IDNA
Domain hit(s) vs Pfam DYW_deaminase [PF14432], Evalue: 6.00E-20, Aligned region: 176..201
DYW_deaminase [PF14432], Evalue: 6.00E-20, Aligned region: 213..324
OTT_1508_deam [PF14441], Evalue: 0.0022, Aligned region: 152..313
Protein Sequence: 346 a.a.     [Download]
>gi|325298233|ref|YP_004258150.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MIYQAILKIKGKEIPLLYYSYQCHLRHCDDSNLGRIIQLHIEACEKTGNREYLPVEGDLIMLMFECSGDE
QLFYDWLNEGNMHYGEIHFIYNESEVVDIFRFGDCFCLKIEESMSAVNSPMVMTVYLSPGIIKRNNLEAR
EKEWKVSENLTHINFNAIESDEFLMRNNKTTNSVSNQRQKQELEEQELKTQSKEAWKRAEKINLLLPPSN
RGKTICSDGIVTVSGYSKERVSKKFRKQVPNFVDVPVLSVIEEALKLNHKLHENSSLDNGLPGSSSASHA
EKQMLVIQNTDIAIGVNRKMCDCCKKFIQKLSNEINKTIYITTPPGLTEIYTPSKNDEDESVIDND
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1241488-1242528 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGATTTATCAGGCAATATTGAAAATAAAAGGCAAAGAGATACCGTTGCTCTATTACAGCTACCAGTGTC
ATCTCCGGCACTGTGACGATTCGAATTTGGGGCGAATCATACAGCTGCATATTGAGGCTTGTGAAAAGAC
CGGTAATAGAGAATACTTACCAGTTGAAGGAGACCTGATCATGCTCATGTTTGAATGCAGCGGTGACGAG
CAGCTCTTTTATGACTGGTTGAATGAAGGAAACATGCACTACGGAGAAATCCATTTCATCTATAACGAAA
GTGAGGTTGTGGACATTTTCCGGTTTGGGGACTGCTTCTGCTTGAAGATAGAGGAAAGCATGAGTGCCGT
GAACTCTCCGATGGTGATGACCGTGTATCTGTCACCGGGGATTATCAAGAGGAATAATCTGGAGGCGAGG
GAGAAGGAATGGAAGGTGTCGGAAAATTTAACACATATAAATTTCAATGCCATTGAAAGTGATGAATTTC
TGATGCGTAATAATAAAACGACAAATTCAGTATCAAATCAAAGACAAAAACAAGAATTAGAAGAGCAAGA
GTTAAAGACTCAATCTAAAGAGGCTTGGAAAAGAGCTGAAAAAATAAACCTACTATTGCCTCCGAGTAAT
AGGGGAAAAACTATATGTTCTGATGGAATAGTTACAGTTAGCGGATATAGCAAAGAAAGGGTCAGTAAAA
AATTTAGAAAGCAGGTCCCTAATTTTGTTGATGTTCCTGTTTTATCAGTTATAGAAGAAGCTCTAAAATT
AAACCATAAATTACATGAAAATTCTTCTTTAGATAATGGACTACCTGGTAGTAGTAGTGCATCGCATGCA
GAAAAACAAATGCTTGTGATACAAAATACAGATATTGCGATTGGTGTAAACAGAAAAATGTGTGATTGTT
GTAAGAAATTTATACAAAAACTATCTAACGAAATAAATAAAACTATATATATAACCACTCCTCCTGGGCT
AACAGAGATATATACTCCTTCAAAAAATGATGAAGATGAAAGTGTTATAGATAATGATTAA