SecReT6
Protein ID: 326316321
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1504
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1673795..1674277 [-]
Producthypothetical protein
NoteTssD
UniProt IDF0Q324
KEGG IDaaa:Acav_1504
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|326316321|ref|YP_004233993.1| hypothetical protein Acav_1504 [Acidovorax avenae subsp. avenae ATCC 19860]
MSVDMFMKVEGASGESQDANHKSWTDIRSFTWGATQPNSMATGSGAGAGKVTFHDLNVVAKIDKAYPAVL
KHCATGKHLGQVEISMCKAGGTQIEFGKITLTDVLVTSVTVSGTDGSDAVLVNYAFQAAKIKTQYWEQTN
QGGKGAESQAGYDIKGNKEM
 
Nucleotide Sequence: 483 bp     [Download]
>gi|326314823|ref|NC_015138.1|:c1674277-1673795 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGTCCGTCGATATGTTCATGAAGGTTGAAGGTGCCAGCGGCGAATCTCAAGACGCCAACCACAAGAGCT
GGACCGACATCCGTTCCTTCACCTGGGGCGCGACGCAGCCCAACTCGATGGCCACGGGCAGCGGCGCCGG
CGCCGGCAAGGTCACCTTCCACGACCTGAACGTGGTGGCAAAGATCGACAAGGCTTATCCGGCCGTCCTC
AAGCACTGCGCGACCGGCAAGCACCTGGGTCAGGTGGAGATCTCGATGTGCAAGGCGGGCGGCACGCAGA
TCGAGTTCGGCAAGATCACCCTCACCGACGTCCTCGTCACGAGCGTGACGGTGAGCGGCACCGATGGCAG
CGACGCCGTGCTGGTGAATTACGCCTTCCAGGCAGCCAAAATCAAGACCCAATACTGGGAACAGACGAAC
CAGGGCGGCAAGGGCGCCGAAAGCCAGGCTGGCTACGACATCAAGGGCAACAAGGAAATGTAA