SecReT6
Protein ID: 326316324
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1507
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1677461..1679818 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDF0Q327
KEGG IDaaa:Acav_1507
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.60E-10, Aligned region: 30..97
Protein Sequence: 785 a.a.     [Download]
>gi|326316324|ref|YP_004233996.1| FHA domain-containing protein [Acidovorax avenae subsp. avenae ATCC 19860]
MDKVELRVIRHADEAVDRLWTAVFGVAGGTIGRGGQNKLVLSDGDAGVARVHAMVRIESEAAFIANLCER
RSIFVAGAEVRSGEEVRLSVGDEVRIGPYVLHSVVPGSPFVPVAAAPAPAAVPAPAPVSAPSPVAIPSPP
VAAASEPVSVAAPVANVPQGEGLPVAPSQPVAMPVTGMGDGLAAVASSAEDDDNPFAMLGRVEGPAIAAV
APSQAPVASPTASSVPAPASAPAFSSVPTATPAPPAGSAPVPVPDEAHGFATSPAPVPAGPGGQGNAWPP
AVPQDRPAAAPRALVIPEDFDLFAADPRKSEEKKDAWGSGLQAKSLSEIANMRHDELLQSLPASGAKFAH
DMDNPAHAGLPKALDPRDELDPLRLFTGDSDATPALVPERSAMALGSGSDLSQSFSLPRGVQAPVGQGLP
GAAPAPGGPVPIAQGAGTGPGMASAAPSAPPLDGLQRVEGLDLGAFGSGATSADPLGWPPVESGPVAAPA
PAPVAADALLQAMPSGLAAGDARAVAIEEVPLAHVPAAAGAVPAPVPAPAPTMAPAPIQATAPAPAAPHG
PAREEGSAKSPLVPVLPELEAASPAELQSLIAAFLDGAGVLQKKVEPQKLSPEFMRSFGEAFRVAVQGTI
DLLAARSEIKREFRAGVTVISSGANNPLKFLPTPEGVVMQMIGQNFPGFMKPIPAMQEAYDDLRVHQVAL
MAGLRAAYAEALERFDPAALEQRTDVTGGVFGKLSATSRKAALWDEYKRNFAEIRRGAEDDLAAFSGQAF
LEAYENAEAAAKART
 
Nucleotide Sequence: 2358 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1677461-1679818 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGGATAAAGTCGAACTCAGGGTCATCCGCCATGCGGACGAAGCGGTGGACCGCCTATGGACGGCGGTAT
TCGGCGTGGCGGGAGGAACGATTGGCCGCGGGGGGCAGAACAAGCTCGTGCTGTCCGACGGCGATGCCGG
CGTCGCCCGCGTGCATGCAATGGTGCGCATCGAGTCGGAGGCCGCCTTCATCGCCAATCTCTGCGAGCGC
CGCTCGATTTTCGTGGCGGGTGCCGAAGTGCGCTCGGGCGAAGAGGTGCGCCTGTCCGTGGGGGACGAGG
TTCGCATCGGCCCCTATGTCCTGCATTCCGTCGTGCCGGGCTCGCCCTTCGTTCCCGTGGCGGCTGCTCC
TGCTCCTGCTGCAGTCCCCGCTCCCGCACCTGTATCTGCACCCTCTCCGGTAGCGATTCCGTCGCCTCCG
GTTGCCGCCGCCAGCGAGCCCGTGTCCGTGGCTGCTCCGGTGGCGAACGTGCCACAGGGCGAAGGGCTTC
CTGTCGCGCCGTCGCAGCCTGTGGCGATGCCCGTGACCGGCATGGGCGACGGCCTGGCGGCGGTTGCGTC
CTCCGCCGAGGACGACGACAACCCATTTGCGATGCTCGGTCGCGTGGAGGGGCCGGCCATCGCAGCCGTG
GCCCCGTCCCAGGCGCCGGTCGCCTCGCCCACGGCTTCGTCCGTACCTGCACCTGCATCGGCCCCTGCGT
TCAGCTCCGTTCCCACCGCCACACCCGCGCCGCCAGCCGGGTCCGCGCCTGTTCCAGTCCCGGACGAGGC
CCATGGCTTCGCCACGTCTCCCGCCCCGGTGCCTGCCGGTCCTGGTGGGCAGGGCAATGCCTGGCCACCG
GCGGTGCCGCAGGACAGGCCCGCCGCGGCACCCCGGGCCCTGGTCATTCCGGAAGACTTCGATCTTTTCG
CGGCGGACCCCCGCAAGAGCGAAGAAAAGAAGGACGCCTGGGGGAGCGGCTTGCAGGCGAAGAGCCTGAG
CGAGATCGCCAACATGCGGCACGACGAGCTCCTGCAGTCGCTGCCGGCCAGCGGCGCGAAATTCGCGCAC
GACATGGACAATCCGGCCCATGCCGGCCTGCCCAAGGCACTGGACCCGCGCGACGAACTCGATCCGCTGC
GTCTCTTCACGGGCGACTCGGATGCAACGCCGGCACTCGTGCCCGAACGGTCGGCGATGGCGCTCGGTTC
GGGGTCCGACCTGTCGCAGTCTTTCAGCCTTCCCCGGGGCGTGCAGGCACCGGTGGGCCAGGGGCTGCCC
GGCGCAGCACCGGCGCCGGGAGGCCCCGTGCCGATCGCCCAGGGGGCGGGTACCGGCCCGGGCATGGCTT
CCGCCGCGCCGTCGGCCCCTCCGCTGGATGGGTTGCAGCGCGTGGAGGGCCTTGACCTGGGGGCCTTCGG
CTCCGGGGCCACTTCGGCCGATCCACTGGGCTGGCCGCCGGTGGAAAGCGGGCCCGTAGCCGCACCCGCG
CCCGCGCCCGTGGCTGCCGATGCGCTGCTGCAGGCCATGCCTTCGGGGCTGGCTGCCGGCGATGCGAGGG
CGGTAGCCATCGAGGAGGTGCCGCTGGCGCATGTTCCTGCCGCGGCAGGTGCCGTGCCGGCTCCCGTCCC
TGCGCCTGCTCCGACCATGGCGCCCGCTCCAATCCAGGCAACTGCTCCTGCCCCCGCCGCGCCCCATGGC
CCGGCAAGGGAGGAGGGCTCCGCGAAGTCGCCCCTGGTTCCGGTGCTGCCGGAACTGGAAGCCGCTTCGC
CTGCGGAGCTGCAGTCGCTGATCGCCGCCTTCCTGGATGGCGCGGGAGTGCTGCAGAAGAAGGTCGAGCC
GCAGAAGCTCAGCCCCGAGTTCATGCGGTCCTTCGGGGAGGCCTTCCGCGTGGCCGTGCAGGGCACCATC
GACCTGCTGGCAGCCCGCTCCGAGATCAAGCGCGAATTCCGTGCGGGCGTGACGGTGATTTCCTCCGGCG
CGAACAATCCGCTGAAGTTCCTTCCGACGCCCGAGGGCGTGGTCATGCAGATGATCGGGCAGAACTTCCC
GGGATTCATGAAGCCCATTCCCGCCATGCAGGAGGCCTACGACGACCTGCGTGTCCACCAGGTGGCCCTG
ATGGCCGGGCTGCGTGCGGCCTATGCCGAGGCGCTGGAGCGCTTCGATCCTGCGGCCCTGGAGCAGCGCA
CCGACGTGACCGGAGGGGTGTTCGGCAAGCTGTCGGCCACGAGCCGCAAGGCGGCGCTGTGGGACGAGTA
CAAGCGCAATTTCGCCGAGATCCGGCGCGGCGCCGAGGACGACCTGGCGGCCTTCTCCGGCCAGGCCTTC
CTGGAGGCCTATGAAAACGCCGAGGCGGCAGCGAAGGCCAGGACGTGA