SecReT6
Protein ID: 326316326
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1509
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1680647..1681228 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF0Q329
KEGG IDaaa:Acav_1509
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.90E-34, Aligned region: 23..168
Protein Sequence: 193 a.a.     [Download]
>gi|326316326|ref|YP_004233998.1| type VI secretion lipoprotein [Acidovorax avenae subsp. avenae ATCC 19860]
MHRETMARKGFIRAGLAAAVAAWLLGGCGMISNLNRPQEAPTAVPPAVFEIVADPGVNPDIHGTPKPILL
RIYELRAAAAFDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERKGSADVRTFAVFAGYRDLERS
TWRATAGAPNSVEMRRRWWGLGETERLKPVQYSITVGKDAVKIQTAPAPAPAR
 
Nucleotide Sequence: 582 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1680647-1681228 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGCATCGGGAAACGATGGCACGGAAGGGATTCATCAGGGCGGGGCTCGCGGCTGCGGTGGCGGCATGGC
TGCTGGGCGGCTGCGGCATGATCAGCAACCTGAACCGCCCCCAGGAGGCGCCCACGGCGGTGCCGCCGGC
CGTCTTCGAGATCGTCGCGGACCCTGGCGTCAACCCCGATATCCACGGCACGCCCAAGCCCATCCTGCTG
AGGATCTACGAACTGCGCGCGGCGGCGGCCTTCGACCGGGCCAGCTACCTGGACCTGCAGGACAAGGACG
AGGCCCAGCTGGGGGCCGATTTCGTGCGGCGCGAGGAAATCCTGCTGCAGCCGGGCGAGCGGCGCACGAT
CGAGCGCAAGGGCAGTGCGGATGTCCGTACCTTCGCGGTGTTCGCAGGCTACCGCGACCTGGAGCGCAGC
ACCTGGCGCGCGACCGCGGGCGCTCCCAATTCCGTGGAGATGCGCCGCCGCTGGTGGGGCCTGGGCGAGA
CCGAGCGGCTCAAGCCCGTGCAGTACAGCATCACGGTGGGCAAGGACGCGGTGAAGATCCAGACCGCCCC
TGCTCCCGCCCCCGCTCGTTGA