SecReT6
Protein ID: 326316327
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1510
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1681276..1682610 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDF0Q330
KEGG IDaaa:Acav_1510
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-161, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|326316327|ref|YP_004233999.1| type VI secretion protein [Acidovorax avenae subsp. avenae ATCC 19860]
MVWQRKVVWAEGMFLRPQHFQQQDRYTDFLVQSRTLPAQFFFWGFSKLALDTELLGLGKLGLLSAEGVLP
DGTPFSFPHHDQAPAALAIGKDVKDTVIHLALPMRRRAGAEVTLGAPGGASVRYAAEVAEVQDANDMGAQ
AAEVQIGNIQLSLRAAQDVTDGWVSLPVAQVVERRADGSLLLDPSFIPTVVNNSEMSGLATFCRELFGLL
RQRGAALEERLSQPGRGGVGEVGDFLMLQFLNRWEPAVEHWVRVRAIHPERLFDDLLKMAGELATFTREQ
RRPAAMPTYDHDDLRSCFLPLMLELRRGLSSVLEQNAIQIELQERQYGVHVALIPSTELLTSCDFVLAVH
AQTAVEFLRAHFPTQIKMGPVERIRDLVNLHLPGVPLRSLPVAPREIPYHAGYSYFELDTGHDLWRQLQN
SGGLALHVSGGFPELQLEMWAIRR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1681276-1682610 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGGTTTGGCAGCGCAAGGTCGTCTGGGCCGAAGGGATGTTCCTTCGCCCGCAGCATTTCCAGCAACAGG
ACCGCTACACCGATTTCCTCGTGCAGTCCCGCACATTGCCGGCGCAGTTCTTCTTCTGGGGGTTTTCCAA
GCTGGCGCTCGACACGGAGCTCCTGGGACTGGGCAAGCTGGGCCTGCTGTCCGCAGAGGGCGTGCTTCCG
GACGGCACGCCGTTCAGCTTTCCGCACCATGACCAGGCTCCCGCTGCGCTGGCGATCGGCAAGGATGTCA
AGGACACGGTCATCCACCTGGCCCTGCCGATGCGGCGCCGGGCGGGCGCGGAAGTGACGCTGGGCGCGCC
CGGCGGCGCGTCGGTGCGCTATGCGGCCGAGGTGGCGGAGGTCCAGGATGCCAACGACATGGGCGCGCAG
GCGGCCGAGGTGCAGATCGGGAACATCCAGCTGTCGCTGCGTGCCGCGCAGGATGTCACCGACGGGTGGG
TGAGCCTGCCCGTGGCCCAGGTGGTGGAGCGCCGGGCGGATGGATCCCTGCTGCTGGATCCGTCCTTCAT
TCCCACCGTGGTCAACAACTCCGAGATGTCAGGCCTGGCCACGTTCTGCCGCGAGCTTTTCGGCCTGCTT
CGGCAGCGGGGCGCGGCGCTGGAGGAGCGGCTGAGCCAGCCCGGCCGGGGCGGCGTGGGCGAGGTCGGCG
ATTTCCTGATGCTCCAGTTCCTGAACCGCTGGGAGCCGGCGGTGGAGCACTGGGTCCGCGTGCGGGCCAT
TCATCCCGAGCGGCTGTTCGACGATCTGCTGAAGATGGCCGGCGAACTGGCGACCTTCACCCGCGAACAG
CGCCGGCCCGCGGCGATGCCGACCTATGACCACGACGATCTGCGCAGCTGTTTCCTGCCGCTGATGCTCG
AGTTGCGCCGGGGGTTGTCCTCGGTGCTGGAGCAGAACGCGATCCAGATCGAGCTGCAGGAACGCCAGTA
CGGCGTGCACGTGGCGCTCATCCCCAGCACGGAACTGCTCACCAGCTGCGACTTCGTGCTGGCGGTGCAC
GCACAGACCGCCGTGGAGTTCCTGCGGGCGCACTTCCCCACGCAGATCAAGATGGGACCGGTGGAACGCA
TCCGCGACCTCGTGAACCTGCACCTGCCCGGCGTGCCGCTGCGTTCGCTGCCCGTCGCGCCGCGGGAGAT
TCCCTATCACGCGGGCTACTCCTACTTCGAGCTGGACACCGGGCACGACCTGTGGCGCCAGCTGCAGAAC
TCGGGCGGCCTGGCGCTGCACGTCTCGGGCGGCTTTCCTGAGCTGCAGCTCGAAATGTGGGCCATACGGC
GCTGA