SecReT6
Protein ID: 326316328
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1511
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1682625..1683977 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF0Q331
KEGG IDaaa:Acav_1511
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-69, Aligned region: 48..253
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 316..414
Protein Sequence: 450 a.a.     [Download]
>gi|326316328|ref|YP_004234000.1| DotU family type IV / VI secretion system protein [Acidovorax avenae subsp. avenae ATCC 19860]
MQNSVNVFASGHPGQPAGAVPASAPPGGTGAESGAKPSGLPDVVSGGNPLVAAANTLLNLIPQIRRMATN
PDPAAFQHYLLECIRHFESRAGGAGVPMETIIGARYCICTAIDEAAAQTPWGGSGVWPQYSLLVALHNET
WGGEKFFQLLSKLVQTPHQHIDLIELMYFCLTLGFEGRYHVIDNGRSQLESLKARLLQVIESTRGDRSGA
LSLHWRGVQRAAVPPWSLVPFWVAAALTLLIAFLIFLWFNYRLASRSDELFAAINAIRLPKMPSVVAVAP
PKPRLRQFLEPEIREGLVEVNDQADRSTVTLRGDGLFEPASTEVKPRYVAVIQRVASALNEVSGKVVVNG
YSDNQPIRTARFPSNWHLSQERAQAVAAMLQRTITDGSRVKAEGRAESDPIAPNSTPEGRALNRRVEIVL
LVPPQARDAELQLTPGPAAAGTPAPGTPKN
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1682625-1683977 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGCAGAACTCCGTCAACGTTTTCGCCTCCGGCCATCCGGGCCAGCCCGCCGGGGCCGTCCCCGCGTCCG
CGCCGCCCGGCGGCACCGGTGCCGAGTCCGGCGCCAAGCCGTCGGGCCTGCCCGATGTCGTGAGCGGCGG
CAATCCGCTCGTGGCCGCGGCCAATACCCTGCTGAACCTCATTCCGCAGATCCGCCGCATGGCGACCAAT
CCCGATCCCGCGGCATTCCAGCACTACCTGCTCGAATGCATCCGGCATTTCGAGAGCCGGGCGGGCGGCG
CTGGCGTGCCGATGGAAACCATCATCGGCGCGCGCTACTGCATCTGCACCGCGATCGACGAGGCGGCGGC
CCAGACCCCGTGGGGCGGCTCGGGCGTGTGGCCGCAGTACAGCCTGCTCGTGGCACTGCACAACGAGACC
TGGGGCGGGGAGAAGTTCTTCCAGTTGCTGTCCAAGCTGGTGCAGACGCCCCACCAGCACATCGACCTCA
TCGAGCTCATGTACTTCTGCCTGACGCTCGGTTTCGAGGGGCGCTATCACGTCATCGACAACGGGCGCAG
CCAGCTGGAGAGCCTGAAGGCCCGGCTGCTGCAGGTGATCGAGAGCACCCGCGGGGACCGCAGCGGCGCA
CTGTCCCTGCACTGGCGCGGCGTGCAGCGCGCGGCGGTGCCGCCCTGGAGCCTGGTGCCGTTCTGGGTGG
CGGCCGCGCTGACCCTGCTCATCGCCTTCCTGATCTTCCTCTGGTTCAACTACCGGCTGGCATCGCGCTC
GGACGAGCTGTTCGCCGCGATCAATGCGATCCGCTTGCCGAAGATGCCTTCCGTGGTGGCCGTGGCGCCG
CCGAAGCCCCGCCTGCGCCAGTTCCTGGAGCCCGAGATCCGCGAAGGCCTGGTCGAGGTGAACGACCAGG
CGGACCGCAGCACCGTAACCCTGCGCGGGGACGGCCTGTTCGAGCCGGCCTCCACCGAGGTCAAGCCGCG
CTATGTCGCGGTGATCCAGCGTGTCGCGTCCGCGCTCAATGAAGTGTCCGGCAAGGTGGTGGTGAACGGG
TACTCCGACAACCAGCCGATCCGCACGGCACGCTTCCCTTCGAACTGGCACCTGTCGCAGGAGCGCGCCC
AGGCCGTCGCGGCGATGCTGCAGAGGACCATCACCGACGGCTCCCGGGTGAAGGCCGAAGGCCGTGCCGA
GAGCGACCCGATCGCCCCCAACAGCACGCCGGAGGGCCGGGCGCTGAACCGGCGGGTGGAGATCGTGCTG
CTGGTTCCGCCCCAGGCCCGCGATGCCGAGCTGCAGCTGACCCCCGGCCCGGCTGCCGCCGGCACGCCCG
CTCCCGGCACACCGAAGAACTAA