SecReT6
Protein ID: 326316331
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1514
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1688354..1689403 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDF0Q334
KEGG IDaaa:Acav_1514
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-21, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 1.10E-21, Aligned region: 177..209
Protein Sequence: 349 a.a.     [Download]
>gi|326316331|ref|YP_004234003.1| type VI secretion-associated protein, ImpA family [Acidovorax avenae subsp. avenae ATCC 19860]
MIDIEELLEPAADTPPCGQDLTYDAEFLALETAATGKPEQQFGETVIPAEPPDWRDVERRARALLVRTKD
ARVAALLCRALTNIQGVRGMSQGVQLMAGMFARYWDDLHPLPEDGDYFMRMNAVSSLNEITGLLRDLRQQ
DFVRLPGGSISVRDAEAVARGTAAEGGARISLDQLRVALAQAWQQGDESLRAWSTASEALRSLQTTFRDR
LESSQVPDLEQFQSLLVVLNDLVPHAPIGVADVATGAPEEGAAPGAIAVAAGAGAAGAVGEPAGVAGRPA
GLRTRDDALAQLLLVAEFLERTEPTNPAPLLIRRAAKLMGLSFLDILRELSPDSVGQVETITGGQNPSS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1688354-1689403 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGATCGACATCGAAGAGCTTCTTGAACCCGCGGCAGACACGCCGCCCTGCGGCCAGGACCTGACCTACG
ACGCGGAGTTCCTGGCCCTGGAGACCGCGGCCACCGGCAAGCCGGAGCAGCAGTTCGGGGAAACGGTGAT
TCCCGCCGAGCCACCGGACTGGCGGGACGTGGAGCGGCGCGCCCGCGCGCTGCTCGTGCGCACGAAGGAC
GCGCGCGTCGCGGCCCTGCTGTGCCGGGCGCTGACCAACATCCAGGGCGTGCGCGGCATGTCCCAGGGCG
TGCAGCTGATGGCCGGGATGTTCGCCCGGTACTGGGACGACCTGCACCCGCTGCCCGAGGACGGCGACTA
TTTCATGCGCATGAACGCCGTGTCCTCGCTGAACGAGATCACGGGCCTGTTGCGGGACCTGCGCCAGCAG
GATTTCGTGCGGCTGCCCGGCGGCTCGATCAGCGTACGCGATGCGGAAGCGGTGGCGCGCGGCACCGCCG
CCGAAGGCGGCGCGCGCATATCGCTGGATCAACTCCGGGTGGCGCTGGCGCAGGCGTGGCAGCAGGGCGA
CGAGTCCCTGCGCGCCTGGAGCACGGCCAGCGAAGCGCTGCGCAGCCTGCAGACGACGTTCCGCGACCGG
CTGGAAAGCTCGCAGGTTCCGGACCTGGAGCAGTTCCAGTCGCTGCTGGTGGTCCTGAACGACCTGGTGC
CGCATGCGCCCATCGGGGTGGCCGATGTCGCCACGGGTGCGCCGGAGGAGGGCGCTGCTCCTGGAGCCAT
CGCGGTCGCGGCGGGGGCAGGTGCGGCCGGTGCGGTTGGCGAGCCCGCCGGGGTGGCCGGCAGGCCGGCA
GGGCTGCGGACCCGCGACGACGCGTTGGCGCAGCTGTTGCTGGTGGCCGAGTTCCTGGAGCGCACGGAGC
CCACCAACCCCGCGCCGCTGCTGATCCGCCGGGCGGCGAAGCTGATGGGCCTGAGCTTCCTCGACATCCT
GCGCGAATTGTCCCCTGACAGCGTGGGCCAGGTCGAGACGATCACGGGAGGGCAAAACCCGTCGTCCTGA