SecReT6
Protein ID: 326316332
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1515
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1689564..1690112 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDF0Q335
KEGG IDaaa:Acav_1515
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.10E-60, Aligned region: 15..166
Protein Sequence: 182 a.a.     [Download]
>gi|326316332|ref|YP_004234004.1| type VI secretion protein [Acidovorax avenae subsp. avenae ATCC 19860]
MVTLSKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVMADLSGKPVDPLPEIADRKFLDID
IDNFDARMKSIKPRASFNVPNTLTGDGRLHIDLTFESMDDFSPASIARKVGALNSLLEARTQLHNLLSYM
DGKQGAEELIGKVLKDPALLKSLAAMPNRPAGGVTEKTDDAQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1689564-1690112 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGGTGACCTTAAGCAAGACCGGCAAGAGCGGTCAGAAGTTCATTGCCCGCAACCGGGCCCCGCGCGTGC
AGATCGAGTACGACGTCGAGATCTACGGCTCCGAGAAGAAGGTGCAGATTCCCTTCGTCATGGGCGTGAT
GGCGGACCTCTCGGGCAAGCCGGTGGATCCCCTGCCGGAGATCGCGGACCGCAAGTTCCTCGACATCGAC
ATCGACAACTTCGATGCCCGCATGAAGTCGATCAAGCCGCGTGCCTCGTTCAACGTGCCCAACACGCTGA
CGGGCGACGGCCGCCTGCACATCGACCTGACGTTCGAGAGCATGGACGACTTCTCTCCCGCCTCGATCGC
GCGCAAGGTGGGCGCCCTCAACTCCCTGCTGGAAGCCCGCACCCAGTTGCACAACCTGCTGTCGTACATG
GACGGCAAGCAGGGCGCGGAGGAACTGATCGGCAAGGTGCTGAAGGACCCGGCGCTGCTCAAGTCGCTGG
CCGCGATGCCCAACCGGCCCGCCGGCGGCGTGACCGAGAAGACCGACGACGCTCAGTGA