SecReT6
Protein ID: 326316333
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1516
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1690126..1691625 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDF0Q336
KEGG IDaaa:Acav_1516
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-199, Aligned region: 67..492
Protein Sequence: 499 a.a.     [Download]
>gi|326316333|ref|YP_004234005.1| type VI secretion protein EvpB [Acidovorax avenae subsp. avenae ATCC 19860]
MNTTTSLDAVQGTQTLEGSEFTSLLQKEFKPKTDQAREAVESAVQTLAQQALAASSTLSDDAYQTVQAII
AEIDRKLSEQINLIIHHSEFQQLEGAWRGLHHLVHNTEVDELLKIRVMNISKKELHRNMRRFKGVGWDQS
PIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPPDVELLGEMAKVSAAAHCPFIAGASPAMMQMDSWQELA
NPRDLTKIFTNTEYAAWRSLRDSDDSKYIGLAMPRFLARLPYGAKTNPVDEFDFEEETAGGDHSKYAWAN
SAYAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDVAAFIGAQSLHKPAEYYDPDATANANLSARLPYMFACCRFAHYLKCIVRDKIGSFKERSDM
ERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVAEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSK
LPSVKQAGN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1690126-1691625 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGAACACGACGACTTCTCTGGACGCGGTGCAGGGCACCCAGACGCTCGAAGGCAGCGAATTCACATCGC
TGCTGCAAAAGGAATTCAAGCCCAAGACCGACCAGGCGCGCGAGGCGGTCGAATCGGCCGTGCAGACGCT
GGCGCAGCAGGCCCTGGCCGCTTCGTCCACGCTCTCCGACGACGCCTACCAGACCGTCCAGGCCATCATC
GCCGAGATCGACCGCAAGCTCTCAGAGCAGATCAACCTGATCATCCACCACAGCGAGTTCCAGCAACTCG
AGGGCGCGTGGCGCGGCCTGCACCACCTGGTCCACAACACCGAGGTGGACGAGCTGCTCAAGATCCGCGT
GATGAACATCTCCAAGAAGGAGCTGCACCGTAACATGCGCCGCTTCAAGGGCGTGGGCTGGGACCAGAGC
CCCATCTTCAAGAAGGTGTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCTTTCGGCTGCCTGGTGG
GTGACTACTATTTCGACCACAGCCCGCCGGACGTGGAACTGCTCGGCGAGATGGCGAAGGTGTCCGCCGC
CGCCCACTGCCCGTTCATCGCCGGCGCGTCTCCCGCGATGATGCAGATGGACTCCTGGCAGGAGCTGGCC
AACCCCCGCGACCTGACCAAGATCTTCACCAACACCGAGTACGCCGCGTGGCGCAGCCTGCGCGACTCCG
ACGATTCGAAGTACATCGGCCTCGCGATGCCGCGCTTCCTCGCGCGCCTGCCGTACGGTGCCAAGACGAA
CCCGGTGGACGAGTTCGACTTCGAGGAGGAAACGGCCGGCGGCGACCACAGCAAGTACGCATGGGCCAAC
TCCGCCTATGCCATGGCCGTGAACATCAACCGTTCGTTCAAGTACTACGGCTGGTGCACCTCGATCCGCG
GGGTGGAGTCCGGTGGCGCGGTGGACAACCTGCCGGCGCACACCTTCCCGACGGACGATGGCGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAACTGGCCAAGAACGGCTTCATG
CCGCTGGTGCACCGCAAGAACTCCGACGTGGCGGCCTTCATCGGCGCGCAGTCGCTGCACAAGCCGGCCG
AGTACTACGATCCGGACGCCACGGCCAACGCCAACCTGTCTGCACGCCTGCCCTACATGTTCGCGTGCTG
CCGCTTCGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAGCGCTCCGACATG
GAGCGCTGGCTCAACGATTGGATCATGAACTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAGACCA
AGGCCCGCAAGCCGCTGGCCGCGGCCGAGGTGCAGGTGGCCGAAGTGGAAGGCAACCCGGGCTACTACAC
GTCCAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGCCTGACCGTGTCCCTGCGGCTGGTCTCGAAG
CTGCCGTCGGTGAAGCAGGCGGGCAACTGA