SecReT6
Protein ID: 326316334
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1517
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1691750..1692538 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDF0Q337
KEGG IDaaa:Acav_1517
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.90E-50, Aligned region: 137..259
Protein Sequence: 262 a.a.     [Download]
>gi|326316334|ref|YP_004234006.1| virulence protein SciE type [Acidovorax avenae subsp. avenae ATCC 19860]
MQSMNFDFKRPLDRQLAELKDAIRAKPQDASLRVFYFQVLAVYGEWQKALDQLQICAQLDRKAEAMARAY
REVILCEVARRDVFAGKRTPNIVGEPPEWLGWMVEGLQCLAEGRTAQAAELRAAAFEQAPASAGEIDGEA
FEWIADSDARLGPVCELYANGSYYWVPFSSVSQIAFEKPQDLRDLVWSACEVTLQNGGVMHGFIPTRYPG
SETAERDEIRLARATEWRDLGDDQATGWGQRVWATDQGDAALLDVRRVKLSH
 
Nucleotide Sequence: 789 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1691750-1692538 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGCAATCCATGAATTTCGATTTCAAGCGCCCGCTGGACCGCCAGCTGGCCGAGCTCAAGGACGCGATCC
GGGCCAAGCCGCAGGATGCGTCGCTGCGGGTGTTCTATTTCCAGGTCCTGGCGGTGTACGGCGAATGGCA
GAAAGCGCTGGATCAACTGCAGATCTGCGCCCAGCTGGACCGCAAGGCGGAAGCCATGGCGCGTGCCTAC
CGCGAGGTCATCCTCTGCGAGGTCGCGCGCCGCGACGTGTTCGCGGGCAAGCGCACGCCCAACATCGTCG
GGGAGCCGCCCGAATGGCTCGGATGGATGGTGGAAGGCCTGCAGTGCCTGGCCGAGGGCCGTACCGCGCA
GGCTGCGGAACTGCGCGCTGCAGCGTTCGAGCAGGCACCGGCCTCGGCCGGCGAAATCGACGGCGAGGCG
TTCGAATGGATCGCCGACTCCGACGCACGCCTGGGCCCGGTCTGCGAGTTGTATGCCAACGGCAGCTACT
ACTGGGTGCCGTTTTCCAGCGTGTCGCAGATCGCCTTCGAGAAGCCGCAGGACCTGCGCGACCTCGTCTG
GTCGGCCTGCGAGGTCACGCTCCAGAACGGCGGCGTGATGCATGGCTTCATCCCCACGCGCTATCCGGGC
TCCGAGACCGCGGAGCGCGACGAGATCCGGCTGGCACGTGCCACCGAATGGCGCGACCTGGGAGACGACC
AGGCGACGGGCTGGGGCCAGCGCGTATGGGCCACGGACCAGGGCGATGCCGCGCTGCTCGACGTGCGCCG
GGTGAAGCTGTCCCATTGA