SecReT6
Protein ID: 326316335
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1518
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1692555..1693076 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF0Q338
KEGG IDaaa:Acav_1518
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-19, Aligned region: 41..152
Protein Sequence: 173 a.a.     [Download]
>gi|326316335|ref|YP_004234007.1| type VI secretion system lysozyme-like protein [Acidovorax avenae subsp. avenae ATCC 19860]
MATQGREKYGHGKDRLQPALLDRLTDHEPSRRTERAEAVYVTEARLRQALLRDLNWLLNASDASSHIDFE
GLTHAERSVLNFGMKPLAGQLLSELDWKDVEAAILKSILQHEPRILPHTLSVTLAPSSKLFNHHNTLQFE
IRCQFWSSPYPLELLLKTSLDLETGQVSVSEQR
 
Nucleotide Sequence: 522 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1692555-1693076 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGGCGACGCAGGGCAGGGAGAAGTACGGACACGGCAAGGACCGCCTGCAGCCGGCGCTGCTGGACCGGC
TGACCGACCATGAGCCCTCCCGGCGCACGGAGCGGGCCGAGGCGGTGTATGTGACCGAGGCGCGCCTGCG
GCAGGCGCTGCTGCGCGACCTGAACTGGCTGCTGAACGCGTCGGACGCGTCGTCGCACATCGATTTCGAG
GGCCTGACCCACGCCGAACGGTCCGTGCTGAACTTCGGCATGAAACCGCTGGCCGGCCAACTGCTGTCGG
AGCTGGACTGGAAGGACGTGGAAGCGGCCATCCTGAAGTCGATCCTCCAGCACGAACCCCGCATCCTGCC
CCATACCCTGAGCGTGACGCTGGCTCCCTCCAGCAAGCTGTTCAACCACCACAACACCCTGCAGTTCGAA
ATCCGGTGCCAGTTCTGGTCATCGCCCTATCCGCTGGAGCTGCTGCTCAAGACCAGCCTCGACCTGGAGA
CCGGGCAGGTGTCCGTGTCCGAGCAGCGGTGA