SecReT6
Protein ID: 326316336
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1519
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1693150..1695024 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDF0Q339
KEGG IDaaa:Acav_1519
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-209, Aligned region: 6..623
Protein Sequence: 624 a.a.     [Download]
>gi|326316336|ref|YP_004234008.1| type VI secretion protein [Acidovorax avenae subsp. avenae ATCC 19860]
MNPRLVEYYNRELSYLRELGAEFAAAFPKVAGRLSLRELEVADPYVERLLEGFSFLTARIQMKMDAEFPR
LSQRILEMVCPHYLAPTPSMVVVQMEPSGTEGSLVEGYTLEAGSVIRGRKTAEDQTPCDFRTGHAVTLWP
IDLLQARLGGPPLDLPLSRFGLAEEAAGHLRFTLSVRGAAQWRNLRMDRLDLHISAGDAVASHLQELIHE
SVMGVIVHDPQDASKVWAQLPAESVQPEGHEQSQALLPYTHRAFQGHRLLHEYFAFPARFRFFSIRGLRE
ALDRVPGAQVGITLLLRRAQPSLEAQVDRHKFLLHCVPAINLFERPADRIHVSPGVNEYHVVPDRTRPRD
FEVYSVLAVTGHREGQLKDQDFVPFFASVHGLRASEQAYFAVRREPRLFSEHATRFGPRTQYLGSEVFIS
LVDQRAAPFADDLKQLSVRVLCTNRDLPLLMAGKGEQSDFTLVESAPVASVRTVAGPTRPTASIAENEMT
WRLISHLSLNYLAMSDLSEEEGAATLRDLLRLYIDHGDRDLSGQIAAIRSLSIAPVTRRLPQHGQLVYGR
GVGITLGVDEGPLAGVSPWPLASILERFFARHVGVNSYTELSLRSRQRGSIARWKVRPGQRPAA
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1693150-1695024 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGAATCCGCGGCTGGTCGAGTACTACAACCGGGAGCTGAGCTACCTGCGCGAACTGGGTGCGGAGTTCG
CTGCCGCCTTCCCGAAGGTCGCCGGGCGGCTGTCGCTGCGCGAACTGGAGGTGGCCGATCCGTACGTGGA
GCGGCTGCTCGAGGGCTTCAGCTTCCTGACGGCGCGCATCCAGATGAAGATGGACGCGGAGTTTCCGCGC
CTCTCGCAGCGCATCCTGGAGATGGTCTGCCCCCACTACCTGGCCCCGACGCCGTCGATGGTGGTCGTCC
AGATGGAGCCCAGCGGCACGGAAGGCAGCCTGGTCGAGGGCTACACCCTGGAGGCCGGCAGCGTGATCCG
CGGGCGCAAGACCGCGGAAGACCAGACGCCGTGCGACTTCCGCACCGGCCATGCGGTCACGCTCTGGCCC
ATCGACCTGCTGCAGGCCCGCCTGGGAGGGCCGCCGCTGGACCTGCCGCTGTCGCGCTTCGGCCTGGCGG
AGGAGGCCGCGGGGCACCTGCGTTTCACGCTGTCGGTGCGCGGCGCCGCGCAGTGGCGCAACCTGCGCAT
GGACCGGCTCGATCTGCACATTTCGGCGGGGGACGCCGTGGCGTCGCACCTGCAGGAACTGATCCACGAG
TCCGTCATGGGCGTGATCGTTCACGACCCGCAGGACGCCTCCAAGGTCTGGGCCCAGCTGCCGGCGGAGT
CCGTCCAGCCGGAGGGGCATGAGCAGTCCCAGGCCCTGCTGCCGTACACCCACCGGGCGTTCCAGGGGCA
CCGCCTGCTGCACGAGTATTTCGCGTTCCCCGCGCGGTTCCGCTTTTTCTCGATCCGGGGGCTGCGGGAA
GCGCTCGACCGCGTGCCGGGCGCGCAGGTCGGGATCACGCTGCTGCTGCGGCGCGCACAGCCTTCGCTGG
AGGCGCAGGTGGACCGCCACAAGTTCCTCCTGCACTGCGTGCCGGCGATCAACCTGTTCGAGCGCCCGGC
CGACCGGATCCATGTGTCCCCGGGCGTCAACGAATACCACGTGGTGCCGGACCGGACGCGGCCGCGCGAC
TTCGAGGTCTATTCTGTCCTGGCGGTGACGGGCCACCGCGAAGGCCAGCTCAAGGACCAGGATTTCGTGC
CGTTCTTCGCATCGGTGCACGGCCTGCGCGCGAGCGAACAGGCCTATTTCGCCGTGCGCAGGGAGCCGCG
CCTCTTCTCGGAACATGCGACCCGTTTCGGGCCGCGCACGCAGTACCTGGGCAGCGAGGTGTTCATCTCG
CTGGTGGACCAGCGCGCGGCGCCGTTCGCGGACGATCTCAAGCAACTCAGCGTGCGGGTGCTGTGCACCA
ACCGCGACCTGCCGCTGCTCATGGCGGGCAAGGGCGAGCAGAGCGACTTCACCCTGGTGGAATCCGCGCC
CGTGGCCTCGGTGCGCACGGTGGCGGGGCCGACGCGGCCCACGGCCAGCATCGCCGAGAACGAGATGACC
TGGCGGCTGATCTCGCACCTGTCCCTCAACTACCTCGCGATGAGCGATCTGTCGGAGGAAGAGGGCGCGG
CGACGCTGCGCGATCTGCTGCGGCTCTACATCGACCATGGTGACCGCGACCTGTCCGGGCAGATCGCGGC
GATCCGCTCGCTGTCGATCGCGCCAGTCACGCGCCGGCTGCCGCAGCACGGGCAACTGGTCTATGGCCGT
GGCGTGGGCATCACCCTGGGGGTGGACGAAGGGCCGCTCGCGGGCGTGAGCCCCTGGCCCCTCGCGTCGA
TCCTGGAGCGCTTCTTCGCGCGGCATGTGGGCGTCAACAGCTACACCGAGCTGTCGCTGCGGTCGCGGCA
GCGGGGATCGATCGCCCGCTGGAAGGTGCGTCCCGGCCAGAGGCCCGCGGCATGA