SecReT6
Protein ID: 326316337
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1520
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1695021..1696187 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDF0Q340
KEGG IDaaa:Acav_1520
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-111, Aligned region: 41..342
Protein Sequence: 388 a.a.     [Download]
>gi|326316337|ref|YP_004234009.1| type VI secretion protein [Acidovorax avenae subsp. avenae ATCC 19860]
MSERVPAPEDSATPEPVPQPGQGPAPDAGLDASGFWQRLRRDPHPFDLFFALRVLQARSRGHPRFGKALR
PRDEPLRLGQDPSLAFAPATLAEVLPATAGQPERLTVWNFGLYGPNGPLPTHLTEYVRERLRQHDDPTIA
RFSDIFHHRLLLLFFRAWSDAQPVTSLDRPDNDLFGRHLRSLIGYGEASQRDRDTVPDHAKQYLAGHWTR
WTRNPEGLVSALRIFFEVPVELVEFTLHYLELDPEQQTTLSRVPRNARLGVDTVVGSRVPDAQGKFRLRI
GPLPIAQYERFLPGGEDFRALVDWVRNYVGIEFAWDYELILRREDVPPCQLGGSVRLGWTTWSFSGPAQR
DPDDFRLDPELWLASRRRPREDAGAGSRAAPVPAAEAH
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1695021-1696187 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGAGTGAGCGCGTGCCCGCGCCGGAGGACTCCGCAACGCCGGAGCCGGTTCCGCAACCGGGGCAGGGAC
CGGCGCCGGACGCCGGCCTGGATGCCTCGGGTTTCTGGCAGCGGCTGCGGCGCGATCCGCATCCGTTCGA
CCTCTTCTTCGCGCTGCGCGTGCTGCAGGCGCGAAGCCGCGGGCATCCGCGCTTCGGCAAGGCCCTGCGG
CCGCGGGACGAACCGCTGCGCCTGGGCCAGGACCCGTCGCTGGCCTTCGCGCCCGCGACCCTCGCGGAAG
TGCTGCCTGCCACGGCCGGCCAGCCCGAACGCCTCACGGTCTGGAACTTCGGACTCTATGGTCCCAACGG
GCCGCTGCCCACGCACCTGACCGAGTACGTGCGCGAGCGGCTGCGGCAGCACGACGACCCGACGATCGCG
CGCTTCTCGGACATCTTCCACCACCGGCTGCTGCTGCTGTTCTTCCGGGCGTGGTCCGACGCGCAGCCGG
TGACTTCGCTCGACCGCCCGGACAACGACCTGTTCGGGCGCCACCTGCGCAGCCTGATCGGCTATGGCGA
GGCGTCGCAGCGCGATCGCGACACCGTGCCGGACCATGCCAAGCAGTACCTGGCGGGCCACTGGACGCGC
TGGACACGCAATCCCGAAGGCCTGGTGTCGGCCCTGCGGATCTTCTTCGAAGTGCCGGTGGAGCTGGTCG
AATTCACGCTGCATTACCTGGAGCTGGACCCGGAGCAGCAGACCACGCTGTCGCGCGTGCCGCGCAACGC
GCGCCTGGGCGTGGACACGGTGGTGGGCAGCCGCGTGCCCGACGCGCAGGGCAAGTTCCGGCTGCGCATC
GGGCCGCTGCCGATTGCGCAGTACGAGCGCTTCCTGCCGGGCGGCGAGGATTTCCGGGCGCTGGTGGACT
GGGTGCGCAACTACGTCGGCATCGAGTTCGCCTGGGATTACGAACTGATCCTGCGCCGCGAGGATGTCCC
GCCCTGCCAACTGGGCGGCAGCGTCCGGCTGGGTTGGACGACATGGTCCTTTTCCGGCCCCGCGCAGCGC
GATCCGGACGACTTCCGGCTCGACCCCGAACTGTGGCTGGCGTCGCGCAGGCGGCCCCGCGAGGATGCCG
GTGCGGGATCGCGTGCCGCGCCCGTCCCGGCGGCCGAGGCGCACTAG