SecReT6
Protein ID: 326316338
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1521
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1696258..1698996 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF0Q3R5
KEGG IDaaa:Acav_1521
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-40, Aligned region: 233..255
AAA_2 [PF07724], Evalue: 2.90E-40, Aligned region: 642..808
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 233..335
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 648..732
ClpB_D2-small [PF10431], Evalue: 1.20E-15, Aligned region: 816..890
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 647..767
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 34..80
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 485..513
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 628..692
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 712..734
AAA_16 [PF13191], Evalue: 7.20E-11, Aligned region: 787..837
Sigma54_activat [PF00158], Evalue: 9.80E-07, Aligned region: 227..248
Sigma54_activat [PF00158], Evalue: 9.80E-07, Aligned region: 645..763
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 228..293
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 563..588
AAA_25 [PF13481], Evalue: 1.80E-06, Aligned region: 645..674
AAA_19 [PF13245], Evalue: 3.80E-06, Aligned region: 230..257
AAA_19 [PF13245], Evalue: 3.80E-06, Aligned region: 645..669
AAA_22 [PF13401], Evalue: 1.80E-05, Aligned region: 232..253
AAA_22 [PF13401], Evalue: 1.80E-05, Aligned region: 351..394
AAA_22 [PF13401], Evalue: 1.80E-05, Aligned region: 645..670
AAA_22 [PF13401], Evalue: 1.80E-05, Aligned region: 709..734
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 233..278
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 466..496
AAA_17 [PF13207], Evalue: 3.00E-05, Aligned region: 647..685
Clp_N [PF02861], Evalue: 4.20E-05, Aligned region: 29..75
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 233..259
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 297..336
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 647..674
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 646..687
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 233..254
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 282..313
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 615..682
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 800..837
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 235..313
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 646..764
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 217..252
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 647..667
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 756..780
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 233..253
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 648..679
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 837..879
Arch_ATPase [PF01637], Evalue: 0.0032, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.0032, Aligned region: 284..316
Arch_ATPase [PF01637], Evalue: 0.0032, Aligned region: 646..691
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 645..659
DUF258 [PF03193], Evalue: 0.0073, Aligned region: 221..250
DUF258 [PF03193], Evalue: 0.0073, Aligned region: 646..668
RNA_helicase [PF00910], Evalue: 0.01, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.01, Aligned region: 648..669
RNA_helicase [PF00910], Evalue: 0.01, Aligned region: 746..766
Protein Sequence: 912 a.a.     [Download]
>gi|326316338|ref|YP_004234010.1| type VI secretion ATPase, ClpV1 family [Acidovorax avenae subsp. avenae ATCC 19860]
MSEISRQALFGKLNPLLFKSLESATVFCKLRGNPYVELVHWLHQLLQETDSDLIRLLRHFAVDSDRLAAD
VLQSLDRLPRGATSISDFSAQIESSIERGWVYATLMYGESQIRSAYWLSGMVRTRVLANELRAISAEFNK
LGEPALSEVFGRLLPDSPESRLKAADGSGLGGVPGEASGATAEAAGPGEALKRYTVDLTERARLQELDPV
TGRDEEVRQMVDILMRRRQNNPILVGEAGVGKTAVVEGLALRIAAGDVPPPLKDVQLRVVDIGLLQAGAS
MKGEFENRLRSLLDEVQASTVPIVLFIDEVHTLVGAGGQAGTGDAANLLKPALARGVLRTIGATTWAEYK
KYIEKDPALTRRFQLVQIHEPDEAKAVHMLRGVAAKLEGHHKVRIGEDAVAAAVTLSHRYIPSRQLPDKA
VSLLDTACSRVALGLHATPARLESVVRQLEALEVEKGIVQRELGLGVGDAGRFADIGTAIERLLAEKAEL
QERFEREKVLVQQIVDAEAALLKPAAQPAGTGAAPASGEAGSGEAAAAGAEQGAAGPQGAATPEALGALR
QDLARLQGEDPLLQPVVDAGVVAAVVAEWTGIPVGRMVRDEVQSVLTLADTLEKRVIGQRHGLEAITRRI
QTARAQLDNPGKPIGVFLLAGPSGVGKTETALSLAEALYGGEQNLITINMSEYQEAHTVSTLKGAPPGYV
GYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDKGWMEDGEGRYIDFKNTVIILTSNVGSEL
IAGMCRDPELAPQPEALAQAVRKPLLEKFPAALLGRLVVVPYYPISDAMLEQIIRLQLKRIQTRIAERHG
AVLDIDDAAVQLIRQRCTEVESGARMVDGIITQNLLPRLAMRFLQSSVDSKSIRHIRLGVADSDFAIEYE
EA
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1696258-1698996 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGTCTGAAATCAGCCGGCAAGCCCTTTTCGGCAAGCTCAATCCCCTGCTCTTCAAGTCGCTGGAAAGCG
CGACCGTGTTCTGCAAGCTGCGCGGCAACCCGTACGTGGAACTGGTGCACTGGCTGCACCAGCTGCTGCA
GGAGACCGATTCCGACCTGATCCGGCTGCTGCGCCATTTCGCGGTGGATTCCGACCGGCTCGCCGCCGAC
GTGCTGCAGAGCCTGGACCGCCTGCCGCGGGGCGCCACCTCGATCAGCGATTTCTCGGCGCAGATCGAAT
CCTCGATCGAGCGCGGCTGGGTGTATGCCACGCTGATGTACGGCGAATCGCAGATCCGCAGCGCCTACTG
GCTCTCGGGCATGGTGCGCACGCGCGTGCTGGCCAACGAGTTGCGCGCGATCTCGGCGGAGTTCAACAAG
CTGGGCGAGCCGGCTTTGAGCGAGGTGTTCGGCCGCCTGCTGCCGGATTCGCCGGAATCGCGCCTGAAGG
CCGCGGACGGTAGCGGCCTGGGCGGCGTGCCCGGCGAGGCGAGCGGCGCCACGGCCGAGGCGGCCGGGCC
CGGCGAGGCGCTGAAGCGCTACACGGTGGACCTGACGGAGCGCGCGCGCCTGCAGGAGCTGGACCCGGTC
ACCGGCCGCGACGAGGAAGTGCGCCAGATGGTGGACATCCTCATGCGCCGGCGCCAGAACAACCCCATCC
TGGTCGGAGAGGCCGGCGTGGGCAAGACGGCGGTGGTGGAAGGCCTCGCGCTGCGCATCGCGGCGGGCGA
CGTGCCGCCGCCACTCAAGGACGTGCAGCTGCGCGTGGTGGACATCGGCCTGCTGCAGGCCGGCGCGAGC
ATGAAGGGCGAGTTCGAGAACCGGCTGCGCTCGCTGCTCGACGAGGTGCAGGCCAGTACCGTGCCGATCG
TATTGTTCATCGACGAAGTGCACACGCTGGTCGGCGCGGGCGGGCAGGCGGGCACGGGCGATGCCGCCAA
CCTGCTCAAGCCGGCGCTGGCGCGCGGCGTGCTGCGCACCATCGGCGCCACCACCTGGGCCGAGTACAAG
AAATACATCGAGAAGGACCCGGCGCTCACCCGCCGCTTCCAGCTCGTGCAGATCCACGAGCCGGACGAGG
CCAAGGCGGTGCACATGCTGCGCGGCGTGGCCGCCAAGCTCGAAGGCCACCACAAGGTGCGCATCGGCGA
GGATGCCGTGGCCGCCGCGGTGACGCTGTCGCACCGCTACATCCCATCGCGCCAGTTGCCGGACAAGGCC
GTGAGCCTGCTGGACACGGCCTGCTCGCGCGTGGCGCTGGGCCTGCATGCCACGCCGGCGCGGCTGGAGT
CGGTGGTGCGGCAACTGGAGGCGCTGGAGGTCGAGAAGGGCATCGTGCAGCGCGAACTGGGCCTGGGGGT
CGGCGATGCCGGCCGCTTCGCCGACATCGGCACCGCGATCGAGCGCCTGCTGGCCGAGAAGGCCGAACTG
CAGGAGCGGTTCGAGCGCGAGAAGGTGCTGGTGCAGCAGATCGTGGACGCGGAGGCCGCGTTGCTGAAGC
CGGCCGCCCAGCCTGCCGGAACCGGGGCGGCGCCGGCTTCCGGAGAAGCCGGCAGCGGCGAGGCGGCTGC
CGCCGGCGCGGAGCAGGGCGCGGCGGGGCCACAGGGGGCTGCCACCCCCGAGGCGCTGGGCGCGCTGCGC
CAGGACCTGGCCCGCCTGCAGGGCGAAGACCCGCTGCTGCAGCCCGTGGTGGATGCGGGCGTGGTGGCCG
CGGTGGTGGCCGAGTGGACGGGCATTCCCGTGGGCCGCATGGTGCGCGACGAGGTGCAGTCCGTGCTGAC
GCTCGCCGACACGCTGGAGAAGCGGGTGATCGGCCAGCGCCACGGCCTGGAGGCGATCACGCGGCGCATC
CAGACCGCGCGTGCCCAGTTGGACAACCCGGGCAAGCCGATCGGCGTGTTCCTGCTGGCCGGCCCGTCGG
GCGTCGGCAAGACCGAGACCGCGCTGTCGCTGGCCGAAGCGCTGTACGGCGGCGAGCAGAACCTCATCAC
CATCAACATGAGCGAGTACCAGGAGGCGCACACGGTCTCCACGCTCAAGGGCGCGCCGCCCGGCTACGTG
GGCTACGGTGAAGGCGGCGTGCTGACCGAGGCCGTGCGCCGCCGTCCCTACAGCGTGGTGCTGCTCGACG
AGATCGAGAAGGCCCACCCGGACGTGCACGAGCTGTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGA
CGGCGAGGGCCGCTACATCGACTTCAAGAACACGGTCATCATCCTGACCTCCAACGTGGGCTCGGAACTG
ATCGCCGGGATGTGCCGGGACCCGGAGCTGGCACCCCAGCCCGAGGCGCTGGCCCAGGCGGTGCGCAAGC
CGCTGCTGGAGAAGTTCCCGGCCGCGCTGCTGGGCCGGCTGGTGGTGGTGCCGTACTACCCGATCTCGGA
TGCGATGCTCGAGCAGATCATCCGCCTGCAGCTCAAGCGCATCCAGACGCGCATCGCCGAGCGCCACGGC
GCCGTGCTGGACATCGACGATGCCGCCGTGCAGCTCATCCGCCAGCGCTGCACCGAGGTGGAATCCGGTG
CCCGGATGGTGGACGGAATCATCACCCAGAACCTGCTGCCGCGTCTGGCGATGCGCTTCCTGCAGAGCTC
GGTCGATTCGAAGTCGATCCGCCACATCCGGCTGGGCGTGGCGGACAGCGATTTCGCCATCGAGTACGAG
GAGGCCTGA