SecReT6
Protein ID: 326404483
SecReT6 ID425
T6SS typeN/A
Gene symbol-
Locus tagACMV_23360
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]2584835..2586166 [-]
Producthypothetical protein
NoteTssK
UniProt IDF0J1E0
KEGG IDamv:ACMV_23360
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.20E-161, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|326404483|ref|YP_004284565.1| hypothetical protein ACMV_23360 [Acidiphilium multivorum AIU301]
MSWTNRVVWQEGMFLRSQHFQQQDRWLEAQVRGRVAALRPYPWGISRLAVNRELLGTGRFALAEAEGVFE
DGTCFSLPGEADHPPPFEVPENTRNMLLHLALPVRQPGAAEIAAEDGSTEGRYGAARFEAYDTHSASPEP
AELLIARLRLRYLLDSEDRAGFLCLPVARIVEVSADRRVTLDDRWIPPALVCHAAPPLAGLIAEFSGMIH
QRGEALAARLNAPGTRGVAEVQDFMLLQAINRWQAMLQHWADAAVIHPETLYSAFVSMAGEFATFIEGSR
RPTAYPGYRHDDLQRSFAPVVADLRRALSAVIEQNAVPIPLQERRHGVHVGPIVDRSILRAANFVLTVQA
DVPAETLRRLFPAQVKIGAVEHIRELVNVALPGISVRPLPVAPRQIPFYAGATYFELDRGSPHWQQMQNS
GAFALHVSGEFPGLKLELWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2586166-2584835 Acidiphilium multivorum AIU301, complete genome
ATGAGCTGGACCAACAGGGTCGTCTGGCAGGAAGGCATGTTCCTGCGCTCGCAGCATTTCCAGCAACAGG
ACCGTTGGCTCGAAGCCCAGGTGCGCGGCCGGGTGGCGGCGCTGCGGCCCTATCCGTGGGGAATCTCCCG
TCTCGCGGTCAACCGGGAACTGCTCGGCACCGGCCGTTTCGCCCTGGCCGAGGCTGAAGGCGTGTTCGAG
GACGGAACCTGCTTCTCCCTGCCGGGCGAGGCCGATCATCCGCCGCCGTTCGAGGTGCCCGAGAACACGC
GCAACATGCTGCTTCACCTCGCGCTGCCGGTGCGCCAGCCCGGCGCCGCCGAGATCGCCGCGGAAGACGG
CAGCACCGAGGGACGCTACGGCGCCGCCCGCTTCGAGGCCTACGACACGCATTCCGCCTCGCCCGAGCCG
GCGGAGCTGCTGATCGCCCGGCTGCGCCTGCGCTATCTCCTCGACAGCGAGGACCGCGCCGGCTTCCTCT
GCCTGCCGGTCGCGCGGATCGTCGAGGTTTCGGCCGACCGGCGCGTCACGCTGGATGACCGCTGGATTCC
GCCGGCGCTGGTCTGTCACGCGGCGCCGCCGCTCGCCGGGCTGATCGCCGAATTCTCCGGCATGATCCAC
CAGCGTGGCGAGGCGCTCGCCGCCCGGCTCAACGCGCCGGGCACGCGCGGCGTCGCCGAGGTGCAGGATT
TCATGCTGCTCCAGGCGATCAACCGCTGGCAGGCGATGCTTCAGCACTGGGCCGACGCCGCCGTGATCCA
TCCGGAGACCCTCTATTCCGCCTTCGTCTCGATGGCCGGCGAGTTCGCCACCTTCATCGAGGGCAGCCGC
CGGCCCACCGCCTATCCCGGTTACCGGCACGACGATCTGCAACGCAGCTTCGCGCCGGTCGTCGCCGATC
TGCGGCGGGCGCTCTCGGCGGTCATCGAACAGAACGCCGTGCCGATCCCGCTGCAGGAGCGGCGCCACGG
CGTTCATGTCGGCCCGATCGTCGACCGCAGCATCCTGCGCGCCGCGAATTTCGTCCTGACCGTGCAGGCC
GACGTGCCGGCCGAGACCCTGCGCCGGCTGTTCCCCGCGCAGGTGAAGATCGGCGCCGTCGAGCATATCC
GCGAACTGGTCAACGTCGCGCTGCCCGGCATCTCGGTGCGGCCGCTCCCGGTGGCGCCCCGGCAGATCCC
TTTCTATGCCGGCGCCACCTATTTCGAGCTCGATCGCGGCAGTCCGCACTGGCAGCAGATGCAGAATTCA
GGCGCGTTCGCACTGCACGTATCGGGCGAATTTCCGGGGCTGAAACTCGAACTCTGGGCGATCCGCGGCT
GA