SecReT6
Protein ID: 326404484
SecReT6 ID425
T6SS typeN/A
Gene symbol-
Locus tagACMV_23370
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]2586173..2586643 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF0J1E1
KEGG IDamv:ACMV_23370
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-31, Aligned region: 12..144
Protein Sequence: 156 a.a.     [Download]
>gi|326404484|ref|YP_004284566.1| hypothetical protein ACMV_23370 [Acidiphilium multivorum AIU301]
MKRRSIILALPVLLAGCGTPPPKPPAVLSLTITGGANQNPDASGTAEPVAVRVYPLVTAGKFNAADPYSL
LGKATSLLGSDLAGPSEQTIVAPGATVKLTHKLPDQAQSIGIAVFFRAIDRATWRLVAPVKAHETNALTL
RIDGLDAKLVPTKPKG
 
Nucleotide Sequence: 471 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2586643-2586173 Acidiphilium multivorum AIU301, complete genome
GTGAAGCGCCGTTCGATCATCCTCGCACTTCCTGTCCTCCTTGCCGGCTGCGGCACGCCGCCGCCGAAGC
CGCCAGCGGTGCTGTCGCTGACCATCACGGGCGGGGCCAACCAGAACCCCGATGCCTCGGGCACTGCCGA
GCCGGTGGCCGTGCGGGTCTACCCGCTGGTCACCGCCGGCAAGTTCAATGCCGCCGACCCGTATTCGTTG
CTCGGCAAGGCCACGTCCCTGCTCGGCAGCGACCTCGCCGGTCCGTCGGAGCAGACGATCGTCGCGCCCG
GCGCCACGGTGAAGCTGACGCACAAATTGCCGGATCAGGCGCAGTCGATCGGCATCGCCGTGTTCTTCCG
GGCGATCGACCGGGCGACATGGCGCCTCGTCGCGCCGGTGAAGGCGCATGAAACGAACGCGCTGACCTTG
CGGATCGACGGATTGGACGCCAAGCTCGTCCCAACCAAACCGAAGGGCTGA