SecReT6
Protein ID: 326404485
SecReT6 ID425
T6SS typeN/A
Gene symbol-
Locus tagACMV_23380
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]2586640..2588031 [-]
Producthypothetical protein
NoteFha
UniProt IDF0J1E2
KEGG IDamv:ACMV_23380
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.20E-18, Aligned region: 27..95
Protein Sequence: 463 a.a.     [Download]
>gi|326404485|ref|YP_004284567.1| hypothetical protein ACMV_23380 [Acidiphilium multivorum AIU301]
MTLTLSVLRCPDAAPPETRSIEGGEFRIGRGPDNDWVLTDPDRVLSKRHCVIAWRAGAWQIADTSTNGTF
VNQDIEPLGAGRVHALSDGDRIRLGSYEIEARLVERGFGDAGYGGGFGAAPATRPDPFADPFGEDPFAKP
AAPASSPVSDEWFGGGNSISMPDDFAGLPDDDALFGPTPVPDHSPAQNDVFRPAPMAPKLLPDDWDLGLE
PGANTASAGPAWTAPSPLPPPAEIQPPPPAAPAPPAPLSPAPVPPAPLPPAPLPAGAPGGDLLRIFLEAA
GMDGLPPPADPELLMRRLAGLFRAMVGGLRQVMIARAAIKGEFRIEQTMIRARGNNPLKFSADDDDAMAA
LIGLGRRTSDLQAEEAVRDALRDIRLHEIAVMSGMQAAVRALFARLDPAPLRAEAESARALLPAQRKARA
FEAYETLYGQLSAALADDFDNVFGKTFARAYERALSDAEASET
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2588031-2586640 Acidiphilium multivorum AIU301, complete genome
ATGACCCTCACCCTCAGCGTGCTCCGCTGCCCGGATGCGGCCCCGCCGGAAACCCGCAGCATCGAGGGCG
GGGAATTCCGCATCGGCCGCGGTCCGGACAATGACTGGGTGCTCACCGATCCCGATCGCGTGCTGTCCAA
GCGGCATTGCGTGATCGCCTGGCGTGCCGGCGCCTGGCAGATCGCCGACACCAGCACCAACGGCACATTC
GTCAATCAGGACATCGAGCCGCTTGGCGCCGGCCGCGTTCACGCGCTGAGCGACGGCGACCGGATCCGGC
TGGGCAGCTACGAAATCGAAGCCCGTCTCGTCGAGCGCGGCTTCGGGGATGCGGGATATGGCGGTGGTTT
CGGCGCCGCGCCCGCGACCCGGCCGGACCCCTTCGCCGATCCGTTCGGCGAGGACCCGTTCGCCAAGCCC
GCGGCACCCGCTTCCTCTCCCGTATCCGACGAGTGGTTCGGCGGCGGCAATTCGATTTCGATGCCCGACG
ACTTTGCCGGCCTGCCGGATGACGATGCCCTGTTCGGCCCGACGCCGGTGCCCGACCACTCGCCGGCGCA
GAACGACGTCTTCCGCCCCGCGCCGATGGCGCCGAAACTTCTGCCCGATGACTGGGATCTGGGCCTCGAA
CCCGGCGCCAACACGGCGTCGGCCGGCCCGGCATGGACGGCGCCTTCGCCGCTGCCGCCGCCCGCCGAGA
TCCAGCCGCCCCCGCCAGCCGCTCCGGCGCCGCCCGCTCCCCTGTCGCCCGCCCCCGTTCCGCCCGCTCC
CCTGCCGCCCGCTCCCCTGCCGGCCGGCGCGCCCGGCGGCGATCTGCTCAGGATCTTTCTCGAGGCCGCG
GGCATGGACGGGCTGCCGCCGCCGGCGGATCCGGAACTGCTGATGCGTCGCCTCGCCGGTCTGTTCCGCG
CCATGGTGGGCGGGCTGCGCCAGGTGATGATCGCCCGCGCCGCGATCAAGGGCGAATTCCGGATCGAACA
GACGATGATCCGCGCGCGCGGCAACAACCCGCTCAAATTCTCGGCGGATGACGACGATGCGATGGCCGCG
CTGATCGGCCTCGGCCGCCGCACCAGCGATCTGCAGGCCGAGGAGGCGGTGCGGGACGCGCTGCGCGATA
TCCGCCTGCACGAGATCGCGGTGATGAGCGGCATGCAGGCCGCGGTGCGCGCCCTGTTCGCCCGGCTCGA
TCCCGCGCCGCTGCGGGCGGAGGCCGAATCGGCGCGCGCGCTGCTGCCGGCCCAGCGCAAGGCGCGCGCC
TTCGAGGCCTATGAAACATTGTATGGCCAGCTCAGCGCGGCCCTTGCCGACGATTTCGACAACGTCTTCG
GCAAGACCTTTGCCCGCGCCTACGAGCGCGCCCTGTCGGATGCGGAGGCCAGTGAAACGTGA