SecReT6
Protein ID: 326404487
SecReT6 ID425
T6SS typeN/A
Gene symbol-
Locus tagACMV_23400
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]2588626..2590566 [-]
Producthypothetical protein
NoteTssI
UniProt IDF0J1E4
KEGG IDamv:ACMV_23400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-56, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 202..246
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 364..451
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 489..499
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 334..342
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 508..531
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 549..570
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 566..583
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 591..597
Protein Sequence: 646 a.a.     [Download]
>gi|326404487|ref|YP_004284569.1| hypothetical protein ACMV_23400 [Acidiphilium multivorum AIU301]
MTTNIDLLDLQTSLGSGVLTLVGVNGQAALSQCFRYTLSVRAGAGGLDPNDLLYTSVTVAIGSDGTNQTY
INGLVSSVVQKPGNAAGTAIAAGLELWDHELTVVPALWFLGQTLDCRIFQNKTAVAIVKEVLDEFEITSY
ELPSGGTSYDYTVMFNETYLDFINRILARDGLFYYFVHEKSGHKFVVASSSQSLPKLGAVKFAGQTATEV
GVHTLSRADSTTIGKFIGNDYNYETASTGLVSDADTVLKAKGAATRKFYRYPSENPVKEAIGQQVRHQNE
AAEVRAGLFAGGGNTPSMLAPGNAVTITGDPFGIGDYVIAAAALSVTDHAGIGGGTATVDVAFTLFDASV
PWRPELLPKPQIAGLQSALVVGPSGDEIYTNKYGRVKVQFNWDTRGKKDENSSCWVRVIQPWAGAGWGFQ
FLPRIGQEVAISFLESDIDRPVVIGSFYNSGQVSLFNLPAEQNKAGFRSRSTKSGGTSNYSEFSIDDTKG
SEVVLLHAERDYTVEVEHDETRTIGNNRTVTVKKDEAITVDGNQTETVKGNRTFEVKQDHSETVDGNQSV
TVKGKQSVSVQGQQSVSVTGAVTYESMESITLKVGGNSIKIDMTGITLSGTLIKINAQAELSTSGAIAQH
SGSGMLKLQGGIIMVN
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2590566-2588626 Acidiphilium multivorum AIU301, complete genome
ATGACGACTAATATCGATCTGCTTGACCTCCAGACATCGCTTGGTAGCGGCGTCCTGACGCTGGTCGGGG
TCAATGGCCAGGCGGCGCTCAGCCAGTGCTTCCGGTATACGCTGTCGGTGCGCGCGGGTGCCGGCGGGCT
CGATCCGAACGATCTTCTATACACGTCGGTCACCGTCGCGATCGGGTCCGACGGGACGAACCAGACCTAC
ATCAATGGCCTCGTCTCGTCCGTGGTCCAGAAGCCCGGCAACGCGGCCGGTACCGCGATCGCCGCCGGCC
TCGAACTCTGGGATCATGAACTGACGGTCGTTCCCGCCCTCTGGTTCCTCGGGCAGACACTCGATTGCCG
GATATTCCAGAACAAGACCGCCGTTGCCATCGTCAAGGAAGTTCTGGACGAATTCGAGATTACTTCATAC
GAGCTGCCGAGTGGCGGGACGAGCTATGACTATACAGTCATGTTCAATGAGACTTATCTGGACTTCATAA
ATCGCATCCTCGCGCGCGATGGGCTTTTCTATTATTTCGTCCACGAAAAGTCCGGACACAAGTTCGTCGT
CGCCAGCAGCTCGCAATCTCTCCCCAAGTTGGGAGCCGTCAAATTCGCCGGGCAGACCGCGACCGAAGTC
GGGGTTCATACGCTCAGCCGCGCCGACAGCACGACCATCGGCAAGTTCATCGGGAACGACTACAACTATG
AAACGGCATCCACCGGCCTCGTCTCCGATGCGGATACCGTGCTCAAGGCGAAGGGGGCGGCAACCCGCAA
ATTCTATCGCTACCCGTCGGAAAATCCCGTCAAGGAGGCGATCGGACAGCAGGTGCGCCATCAGAACGAG
GCGGCCGAGGTTCGTGCCGGGTTGTTCGCCGGTGGCGGCAACACCCCGTCGATGCTCGCTCCCGGCAACG
CCGTCACCATCACCGGCGATCCCTTCGGCATCGGCGATTACGTCATTGCGGCGGCCGCGCTCAGCGTGAC
CGATCACGCCGGCATCGGCGGAGGGACGGCCACCGTCGATGTCGCATTCACCCTGTTCGACGCATCGGTT
CCCTGGCGGCCGGAACTCCTGCCGAAGCCGCAGATCGCCGGCTTGCAGTCCGCCCTCGTCGTCGGGCCCT
CGGGCGATGAAATTTACACGAACAAGTACGGCCGGGTGAAGGTTCAGTTCAACTGGGACACGCGCGGCAA
GAAGGACGAGAACTCGAGTTGCTGGGTTCGCGTGATCCAGCCCTGGGCCGGCGCCGGCTGGGGGTTCCAG
TTCCTTCCGCGCATCGGCCAGGAGGTCGCCATCAGCTTCCTCGAGAGCGACATCGACCGGCCGGTCGTGA
TCGGTTCCTTCTACAACTCCGGCCAGGTCAGCCTGTTCAATCTCCCCGCCGAGCAGAACAAGGCGGGATT
CCGCTCCCGCTCAACCAAGAGTGGCGGGACGTCGAACTACAGCGAATTCAGTATCGACGATACCAAGGGG
TCGGAGGTTGTCCTGCTGCATGCGGAGCGGGATTATACGGTCGAGGTCGAGCATGATGAAACCCGCACGA
TCGGCAACAACCGCACGGTGACCGTCAAGAAGGACGAGGCGATCACCGTGGACGGCAACCAGACCGAGAC
GGTGAAAGGAAATCGTACCTTCGAGGTCAAGCAGGACCATTCCGAGACGGTCGATGGCAACCAGTCCGTC
ACGGTCAAGGGCAAGCAGAGCGTGTCGGTGCAGGGGCAGCAATCCGTATCCGTGACCGGGGCCGTCACCT
ATGAGTCGATGGAGTCGATCACGCTGAAAGTGGGCGGAAACAGCATCAAGATCGACATGACGGGCATCAC
GCTCTCCGGCACCCTCATCAAGATCAATGCCCAGGCCGAGCTGTCGACGAGCGGCGCGATTGCGCAGCAT
TCCGGCTCGGGGATGCTGAAACTCCAGGGCGGGATCATCATGGTGAACTGA