SecReT6
Protein ID: 326405560
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34130
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3708532..3709017 [-]
Producthypothetical protein
NoteTssD
UniProt IDF0IXJ5
KEGG IDamv:ACMV_34130
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-31, Aligned region: 4..135
Protein Sequence: 161 a.a.     [Download]
>gi|326405560|ref|YP_004285642.1| hypothetical protein ACMV_34130 [Acidiphilium multivorum AIU301]
MAIYMKYGSINGDVTTQGFENYIELGSFQWGVGRGVSMQSGSKQGREASLPSLSEITITKEYDVASGDLL
KEALSGNVQEVDIVFTRTGTGGSGAQQFMKVSMKDVILSGLSMSAGSDGKPMESLSLNYSQISFTNNPMK
DDGTAGPQSVVNFNLGTMVMS
 
Nucleotide Sequence: 486 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c3709017-3708532 Acidiphilium multivorum AIU301, complete genome
ATGGCTATCTACATGAAATACGGCTCTATCAACGGCGACGTCACGACCCAGGGTTTCGAGAATTACATCG
AACTGGGGTCTTTCCAGTGGGGTGTCGGCCGCGGCGTCTCGATGCAGTCGGGCAGCAAGCAGGGCCGCGA
GGCAAGCCTGCCGAGCCTGTCAGAAATCACCATCACCAAGGAATACGACGTCGCGAGCGGCGACCTGCTG
AAGGAAGCGCTGAGCGGCAACGTGCAAGAAGTCGATATCGTCTTCACCCGCACCGGCACGGGCGGCTCGG
GCGCCCAGCAATTCATGAAGGTCAGCATGAAGGATGTCATCCTCTCCGGCCTCTCGATGTCCGCGGGTTC
CGACGGCAAGCCGATGGAATCGCTGTCGCTGAACTACTCGCAGATCTCCTTCACCAACAATCCGATGAAG
GATGACGGCACGGCCGGCCCGCAGAGCGTGGTGAACTTCAACCTCGGCACGATGGTCATGAGCTGA