SecReT6
Protein ID: 326405561
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34140
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3709047..3711695 [-]
Producttype VI secretion system family protein
NoteTssH
UniProt IDF0IXJ6
KEGG IDamv:ACMV_34140
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-42, Aligned region: 229..298
AAA_2 [PF07724], Evalue: 2.20E-42, Aligned region: 611..778
AAA [PF00004], Evalue: 9.70E-19, Aligned region: 231..362
AAA [PF00004], Evalue: 9.70E-19, Aligned region: 617..742
ClpB_D2-small [PF10431], Evalue: 2.00E-13, Aligned region: 502..528
ClpB_D2-small [PF10431], Evalue: 2.00E-13, Aligned region: 784..858
AAA_5 [PF07728], Evalue: 1.80E-12, Aligned region: 231..307
AAA_5 [PF07728], Evalue: 1.80E-12, Aligned region: 616..735
AAA_16 [PF13191], Evalue: 7.40E-07, Aligned region: 118..162
AAA_16 [PF13191], Evalue: 7.40E-07, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 7.40E-07, Aligned region: 586..630
AAA_16 [PF13191], Evalue: 7.40E-07, Aligned region: 681..704
AAA_16 [PF13191], Evalue: 7.40E-07, Aligned region: 776..813
Sigma54_activat [PF00158], Evalue: 8.20E-07, Aligned region: 227..253
Sigma54_activat [PF00158], Evalue: 8.20E-07, Aligned region: 615..737
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 231..324
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 347..391
AAA_22 [PF13401], Evalue: 1.40E-06, Aligned region: 614..647
DUF2075 [PF09848], Evalue: 8.50E-06, Aligned region: 31..83
DUF2075 [PF09848], Evalue: 8.50E-06, Aligned region: 232..333
DUF2075 [PF09848], Evalue: 8.50E-06, Aligned region: 615..651
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 617..644
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 131..154
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 231..254
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 606..657
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 229..249
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 615..638
Torsin [PF06309], Evalue: 0.00032, Aligned region: 571..644
AAA_25 [PF13481], Evalue: 0.00082, Aligned region: 231..255
AAA_25 [PF13481], Evalue: 0.00082, Aligned region: 285..327
AAA_25 [PF13481], Evalue: 0.00082, Aligned region: 614..634
AAA_25 [PF13481], Evalue: 0.00082, Aligned region: 678..700
ResIII [PF04851], Evalue: 0.0041, Aligned region: 218..253
ResIII [PF04851], Evalue: 0.0041, Aligned region: 299..313
ResIII [PF04851], Evalue: 0.0041, Aligned region: 588..636
Protein Sequence: 882 a.a.     [Download]
>gi|326405561|ref|YP_004285643.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MAAIDLKSLIARLDDHCRRSLEAAAGLTLSRSHYNVEIEHWLLKLADGTDTDIPLILRHYEIDIGRFLID
LNRALDRMKTGNARAPALSPEVVELAKQAWLLASVEHGLSRTRSGHLLWALLADETLARHAREASSHFAK
IQPDALKRDFNAITANSIEAQTATRATDGAPATGGTDDGTPRPGGSAALDQFTEDLTARARAGRIDPILG
RDFEIRQAIDILTRRRQNNPIFTGEAGVGKTAVVEGIALKIAQGDVPEALKNVTLRTLDMALLQAGAGMK
GEFENRLKSVIDEVKASPKPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKY
FERDAALTRRFQVVKVEEPSEAMATAMIRGLVGTLEKHHKVRILDEAVSEAVRLSARYIPSRQLPDKAIS
LIDTACARVGMSQATEPAPIEDRRRRIDLIDTETGILRREMASGGDHAAREAELIEERARLVAELAELEA
RFATEKQLAGDIAELRTRLEDDANAEDKDALRASLAEKTAALKASQGENPLIFPVVDGQAVAEIVESWTG
IPAGRMQSDEINTVLKLKEAMEQRIVGQPHALEAVAQAIRTSRAKLTDPRKPIGVFMMVGTSGTGKTETA
LTLANLLYGGEQNMTTINMTEFKEEHKVSLLMGSPPGYVGYGEGGVLTEAVRRRPYSVVLLDEMEKAHPG
VQDVFFQVFDKGNMKDGEGRDIDFKNTIIIMTSNAGTDLIEKLFADPETAPDAAALAEALRPELLKYFKP
AFLGRVTIVPYFPLSDEVIRQIVVLQLNKIAKRVREGYKAEFTYEPALVETIAARCKESASGARNVENIL
SRTLLPELSAEVLARLAEGEMISRVTVGTSEDGMFRYTINQA
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c3711695-3709047 Acidiphilium multivorum AIU301, complete genome
ATGGCTGCTATCGATCTCAAATCTCTGATCGCCCGCCTCGACGACCACTGCCGCCGCAGCCTCGAGGCCG
CAGCCGGCCTAACGCTGTCGCGAAGCCATTACAACGTCGAAATCGAACATTGGCTGCTCAAGCTCGCCGA
TGGCACCGACACCGACATTCCGCTTATTCTTCGACATTACGAGATCGATATCGGTCGTTTCTTGATCGAT
CTCAACCGCGCGCTCGACCGGATGAAGACCGGCAACGCCCGCGCCCCGGCCCTGTCACCGGAAGTCGTCG
AGCTCGCGAAACAGGCCTGGCTGCTGGCATCGGTCGAACACGGGCTGAGCCGCACGCGCTCGGGTCACCT
GCTTTGGGCCCTGCTGGCCGACGAGACCCTAGCCCGCCACGCCCGCGAGGCCTCCAGCCATTTCGCAAAA
ATCCAGCCGGACGCACTGAAGCGCGACTTCAACGCCATCACCGCCAATTCCATCGAGGCGCAGACCGCGA
CCCGCGCGACCGATGGCGCGCCGGCCACGGGCGGCACCGATGACGGCACGCCCCGTCCCGGCGGCTCGGC
GGCGCTGGACCAGTTCACCGAAGATCTGACCGCCCGCGCGCGCGCCGGCCGGATCGACCCGATCCTCGGC
CGCGACTTCGAAATCCGCCAGGCGATCGACATCCTCACCCGCCGCCGGCAGAACAACCCGATCTTCACCG
GCGAGGCAGGTGTGGGCAAGACCGCGGTGGTCGAGGGCATCGCGCTGAAGATCGCCCAGGGCGACGTGCC
GGAGGCGCTGAAGAACGTCACGCTGCGCACGCTCGACATGGCGCTGCTCCAGGCCGGGGCGGGCATGAAG
GGCGAGTTCGAGAACCGGCTGAAATCGGTGATCGACGAGGTGAAGGCCTCGCCGAAGCCGATCATCCTGT
TCATCGACGAGGCGCACACGCTGATCGGCGCCGGCGGCCAGGCCGGCCAGAACGACGCGGCAAACCTGCT
CAAGCCCGCCCTCGCCCGCGGCGAGCTGCGCACCATCGCGGCGACGACCTGGGCCGAATACAAGAAATAT
TTCGAGCGCGATGCCGCGCTGACCCGCCGCTTCCAGGTGGTCAAGGTCGAGGAGCCGTCCGAGGCGATGG
CCACCGCGATGATCCGCGGCCTCGTCGGCACGCTCGAGAAGCACCACAAGGTCCGCATCCTCGACGAGGC
GGTGAGCGAGGCCGTCAGGCTGTCGGCGCGTTATATTCCCTCACGCCAGCTGCCGGACAAGGCGATCTCG
CTGATCGACACGGCCTGCGCCCGCGTTGGCATGAGCCAGGCGACCGAACCCGCCCCGATCGAGGATCGCC
GCCGCCGGATCGACCTGATCGACACCGAAACCGGCATCCTCCGCCGTGAGATGGCCAGCGGCGGCGATCA
CGCCGCCCGCGAGGCCGAACTGATCGAGGAGCGTGCGCGGCTGGTCGCCGAACTCGCCGAGCTCGAGGCC
CGCTTCGCGACCGAGAAGCAGCTCGCCGGCGACATCGCCGAGCTGCGCACCCGGCTGGAAGACGACGCGA
ACGCGGAGGACAAGGACGCGCTGCGCGCCAGCCTCGCCGAAAAGACCGCGGCGCTGAAGGCCTCGCAGGG
CGAGAACCCGCTGATCTTCCCGGTGGTCGACGGCCAGGCCGTCGCCGAGATCGTCGAGAGCTGGACCGGC
ATTCCCGCCGGGCGCATGCAGTCCGACGAGATCAACACGGTGCTGAAGCTGAAGGAGGCGATGGAGCAGC
GCATCGTCGGCCAGCCCCATGCGCTCGAGGCGGTCGCCCAGGCGATCCGCACCTCGCGCGCGAAACTCAC
CGACCCGCGCAAGCCGATCGGCGTCTTCATGATGGTCGGCACCTCCGGCACCGGCAAGACCGAAACGGCG
CTTACCCTCGCCAACCTGCTCTATGGCGGCGAGCAGAACATGACCACCATCAACATGACCGAGTTCAAGG
AAGAACATAAGGTCAGCCTGCTGATGGGCAGCCCGCCCGGCTATGTCGGCTATGGCGAGGGCGGCGTGCT
GACCGAGGCGGTGCGCCGGCGCCCCTATTCGGTGGTGCTGCTCGACGAGATGGAAAAGGCCCATCCCGGC
GTGCAGGACGTCTTCTTCCAGGTGTTCGACAAGGGCAACATGAAGGACGGCGAAGGCCGCGACATCGACT
TCAAGAACACCATCATCATCATGACGTCGAATGCCGGCACCGACCTGATCGAGAAACTCTTCGCCGATCC
CGAAACCGCGCCGGACGCCGCCGCCCTCGCCGAGGCGCTGCGGCCGGAGCTGCTGAAATATTTCAAGCCC
GCCTTTCTCGGCCGCGTCACCATCGTCCCCTATTTCCCGCTCTCCGACGAGGTGATCCGCCAGATCGTGG
TGCTCCAGCTCAACAAGATCGCGAAGCGCGTGCGCGAGGGCTACAAGGCCGAATTCACCTACGAGCCCGC
GCTCGTCGAAACCATTGCCGCACGCTGCAAGGAATCGGCCTCGGGCGCGCGCAACGTGGAAAACATCCTC
TCCCGCACGCTGCTGCCCGAACTCTCGGCCGAGGTTCTGGCCAGGCTTGCCGAAGGCGAGATGATTTCCC
GCGTGACGGTGGGCACATCCGAAGACGGGATGTTCCGCTACACCATCAATCAGGCTTAA