SecReT6
Protein ID: 326405562
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34150
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3711849..3712967 [+]
Producttype VI secretion system family protein
NoteTssA
UniProt IDF0IXJ7
KEGG IDamv:ACMV_34150
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-20, Aligned region: 62..122
Protein Sequence: 372 a.a.     [Download]
>gi|326405562|ref|YP_004285644.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MFLDIDALLAPIEGDSPVGQDLRADYTAGSIYYRLRDARSDARAAERAADSDPTLEADAGQHWRSVLQLA
QTALGKSHDLEVAAWMTEAMVRENGLAGLAEGARLMAGLVHGFWEALYPLPDEDGMETRVAPVAGLNGTG
SDGTLIQPLRKLTLFNAADGSPVPVFLYLQAEETAGLGDEKRKAARIAAGVPAFAQLETQARVAGTGHFT
ALARGAAAALEAWQAMGAAFDEVAGYDAPPTSRVREVLEQIIAISQRYAPGALAAPGGAAENADAAAGAE
AAGAAEDAVAVDGPAPAQAAKKPYTREDALRQLGEIAEFFRRTEPQSPIALTLDEAIRRARLTWPELIED
ILADAGVRQAMLTALGIKPPAD
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|326402148|ref|NC_015186.1|:3711849-3712967 Acidiphilium multivorum AIU301, complete genome
ATGTTTCTCGACATCGACGCCTTGCTTGCCCCGATTGAAGGGGATTCGCCGGTCGGGCAGGACTTGCGTG
CCGACTACACCGCGGGCTCGATTTACTATCGCTTGCGCGATGCGCGCTCGGACGCGCGCGCCGCCGAGCG
CGCGGCGGATTCGGATCCGACGCTCGAGGCCGACGCGGGACAGCATTGGCGCAGCGTGCTGCAACTGGCG
CAAACCGCGCTCGGCAAGTCGCACGACCTGGAGGTTGCCGCCTGGATGACCGAGGCGATGGTGCGCGAGA
ACGGGCTTGCCGGTCTTGCCGAGGGGGCTCGGCTGATGGCGGGCCTTGTCCATGGGTTCTGGGAGGCGCT
TTACCCGTTGCCCGACGAGGACGGCATGGAAACGCGCGTCGCGCCCGTGGCCGGCCTGAACGGGACGGGA
AGCGATGGCACGCTGATCCAGCCGCTGCGCAAGCTGACGCTGTTCAACGCCGCTGACGGGTCGCCGGTGC
CCGTCTTCTTGTATCTCCAGGCGGAGGAGACGGCAGGGCTTGGCGACGAGAAACGCAAGGCGGCGCGGAT
CGCCGCTGGCGTGCCGGCCTTCGCACAGCTGGAGACACAGGCGCGGGTGGCGGGTACGGGCCATTTCACC
GCGCTCGCGCGCGGCGCGGCGGCAGCACTCGAGGCCTGGCAGGCGATGGGGGCGGCCTTCGATGAGGTGG
CTGGGTATGACGCACCGCCGACCTCGCGGGTACGGGAGGTGCTCGAGCAGATCATCGCCATTTCACAACG
ATATGCGCCCGGCGCGCTGGCCGCGCCCGGCGGCGCGGCGGAGAACGCTGACGCAGCCGCCGGAGCGGAG
GCGGCCGGAGCCGCCGAGGATGCCGTCGCCGTTGACGGCCCGGCGCCGGCGCAGGCCGCGAAGAAGCCCT
ATACGCGTGAGGATGCGCTGCGCCAGCTTGGCGAGATCGCCGAATTCTTCCGCCGCACCGAACCGCAATC
GCCGATTGCGCTGACCCTCGATGAGGCGATCCGCCGTGCGCGGCTCACCTGGCCGGAACTGATCGAGGAT
ATTCTGGCCGACGCCGGCGTGCGCCAGGCGATGCTGACGGCGCTCGGCATCAAGCCGCCGGCGGACTGA