SecReT6
Protein ID: 326405563
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34160
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3712989..3714482 [-]
Producttype VI secretion system family protein
NoteTssC
UniProt IDF0IXJ8
KEGG IDamv:ACMV_34160
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.10E-137, Aligned region: 58..491
Protein Sequence: 497 a.a.     [Download]
>gi|326405563|ref|YP_004285645.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MLREAVLAGHFFGERHGGAASELASFLVAKPGQALQAWFGEAATLDLLRNPKALAARIDRDIAAIDALLS
DQLDTILHNPRLTRLEGSWRGLFWLASHIEPGRTIKLRVLHASWSEICRDLERAPEFDQSETFRRIYEDE
FGTPGGEPYGLLVMDYTIRHRPSADSPSDDVSALAALSAVAAASFAPMIFSASPTLFGVDRMEELSGVAD
PASLFTGLEYRRFRNLGLRDDMRFIGLALPRLRARAPWTDAPGAPSLFPYCERIEDSEDMVWFAPGYAVA
FVVARAMATYEWPADMRGYLEDWPGGGLFTAGTAAVFSADPYDGLDRFELEIALTDRQERGLVDAGLMPL
TPLGYGGETVIGAARSLQMPRRFGGPNTEAADANARLSAQFNTMICVSRFAHFLKVMGRDMTGAFRTAAE
IERTLGDWLRRFTNSNRDAGPETRARYPLLDASVQVRELPAKPGSFGCVIHLQPQYQLDDIAASFRLVTE
ISAPGNR
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c3714482-3712989 Acidiphilium multivorum AIU301, complete genome
ATGCTGCGAGAGGCGGTTCTCGCCGGTCACTTTTTTGGCGAGCGCCACGGTGGCGCAGCTTCGGAACTCG
CCTCCTTCCTCGTGGCGAAGCCGGGCCAGGCGCTGCAAGCCTGGTTCGGTGAGGCGGCCACGCTCGATCT
TCTCCGCAATCCCAAGGCGCTCGCCGCCCGGATCGATCGGGACATCGCCGCCATAGATGCCCTTCTCTCG
GATCAACTCGACACGATCCTGCACAATCCGCGCCTGACCCGGCTCGAAGGCAGCTGGCGCGGGCTGTTCT
GGCTGGCCTCGCATATCGAACCGGGCAGGACCATCAAGCTACGCGTGCTGCACGCATCCTGGAGCGAAAT
CTGCCGCGATCTCGAACGCGCGCCGGAATTCGACCAGAGCGAGACCTTCCGCCGCATCTACGAAGACGAA
TTCGGCACGCCCGGCGGTGAGCCCTATGGTCTTCTGGTGATGGACTACACGATCCGCCATCGCCCATCGG
CCGACTCACCGAGCGACGACGTTTCGGCATTGGCGGCGCTTTCCGCTGTCGCGGCCGCGTCCTTCGCCCC
GATGATTTTCAGCGCCTCACCGACACTCTTCGGCGTTGACCGGATGGAGGAACTTTCGGGCGTGGCCGAT
CCGGCGAGTCTGTTCACCGGACTGGAATATCGCCGTTTCCGCAATCTCGGCCTTCGCGACGACATGCGCT
TCATCGGGCTCGCTCTGCCGCGCCTTCGTGCGCGCGCCCCATGGACTGACGCACCAGGCGCCCCCAGCCT
CTTTCCCTATTGCGAGCGGATCGAGGACAGCGAAGACATGGTCTGGTTCGCGCCTGGCTACGCGGTGGCG
TTCGTCGTTGCCCGTGCGATGGCAACCTATGAATGGCCGGCGGACATGCGCGGCTATCTCGAGGACTGGC
CGGGTGGCGGCCTGTTCACCGCCGGTACCGCAGCTGTCTTCTCCGCCGACCCGTATGACGGGCTTGACCG
GTTCGAACTGGAAATCGCCCTGACCGACCGGCAGGAACGCGGTCTGGTCGATGCCGGGCTCATGCCGCTA
ACGCCTCTTGGCTACGGTGGGGAAACGGTGATTGGTGCCGCCCGCAGCCTGCAGATGCCGCGCCGCTTCG
GCGGGCCGAACACCGAGGCCGCCGATGCCAATGCCCGTCTATCCGCTCAGTTCAACACGATGATCTGCGT
CTCCCGCTTCGCTCATTTCCTCAAGGTCATGGGTCGGGACATGACGGGCGCCTTTCGCACCGCAGCCGAA
ATCGAGCGCACGCTCGGCGACTGGCTGCGCCGCTTCACCAACAGCAACCGCGATGCCGGCCCGGAAACAC
GGGCACGGTACCCCCTGCTCGACGCATCGGTCCAGGTACGCGAACTGCCGGCAAAGCCAGGTTCGTTCGG
ATGCGTCATCCACCTCCAGCCGCAATACCAGTTGGACGACATTGCGGCCTCGTTCCGGTTGGTGACCGAG
ATATCGGCGCCGGGCAATCGCTGA