SecReT6
Protein ID: 326405564
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34170
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3714503..3715996 [-]
Producttype VI secretion system family protein
NoteTssC
UniProt IDF0IXJ9
KEGG IDamv:ACMV_34170
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-191, Aligned region: 64..494
Protein Sequence: 497 a.a.     [Download]
>gi|326405564|ref|YP_004285646.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MSQSQSETAAAGATQTGEAVSLLDQVVGATKQTEPDHAQELVKTLVQEALSGTVTFDKNLTRTIDRAIAA
IDARMSRQLNAIMHDAKFLKLEGSWRGLHHLVMNSETGTSLKLKVINMSKRDLNKDLTKAVEFDQSQLFK
KIYENEFGTPGGEPYGALIGDYEWSNHPDDIETLRLVSNVAAAAFAPFISAAGAGMFGFQDWTELSKPRD
LAKIFDTAEYAKWRGFRETEDARFVSLVMPRTLARVPYGASTSPVESFNYEEAPFDASGAARPMDHHDYC
WMNAAYMMGERLTASFASSGFCVAIRGAEGGGKVENLPFHVFQSDDGDTDAKCPTEIGITDRREFELSNL
GFLPLCHYKNTDYAVFFGAQSVQKPKKYDRPDATANAAISARLPYIMASSRFAHFLKVMARDKIGSFMEA
KDCENWLNRWIGNYVNANPDAGQEMKARYPLREAKVEVKEIPGKPGSYNAVAYLRPWLQMEELTTSMRMV
ARIPQKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c3715996-3714503 Acidiphilium multivorum AIU301, complete genome
ATGTCACAGAGCCAATCCGAAACGGCGGCAGCCGGCGCAACGCAAACCGGGGAAGCCGTCTCGCTGCTCG
ACCAGGTCGTCGGCGCAACCAAGCAGACCGAGCCCGATCATGCCCAGGAACTCGTCAAGACGCTCGTCCA
GGAAGCCCTCTCCGGCACCGTCACCTTCGACAAGAACCTCACCCGCACGATCGACCGCGCCATCGCCGCG
ATCGACGCGCGGATGTCCCGCCAGCTCAACGCGATCATGCACGACGCGAAATTCCTCAAGCTCGAGGGCA
GCTGGCGCGGCCTGCATCACCTGGTGATGAACTCCGAGACGGGCACGTCGCTCAAGCTCAAGGTCATCAA
CATGTCGAAGCGGGATCTGAACAAGGATCTCACCAAGGCCGTCGAGTTCGACCAGAGCCAGCTCTTCAAG
AAGATCTACGAGAACGAGTTCGGCACTCCCGGCGGCGAGCCCTATGGCGCGCTGATCGGCGACTACGAAT
GGTCGAACCATCCGGACGACATCGAGACTCTGCGCCTCGTCTCCAACGTCGCTGCGGCGGCCTTCGCGCC
GTTCATCTCGGCGGCTGGTGCGGGCATGTTCGGCTTCCAGGACTGGACGGAACTCTCAAAGCCGCGCGAC
CTCGCCAAGATCTTCGACACCGCCGAATACGCGAAATGGCGCGGCTTCCGCGAAACCGAGGATGCGCGCT
TCGTCTCGCTGGTGATGCCGCGCACCCTCGCCCGCGTGCCCTACGGCGCCAGCACCTCGCCGGTGGAGAG
CTTCAACTACGAGGAAGCGCCGTTCGATGCGAGCGGCGCCGCCCGGCCGATGGACCATCACGACTATTGC
TGGATGAACGCGGCCTACATGATGGGCGAGCGGCTGACCGCGAGCTTCGCCTCCTCGGGCTTCTGCGTCG
CGATCCGCGGCGCCGAGGGCGGCGGCAAGGTCGAGAACCTGCCCTTCCACGTCTTCCAGTCCGATGACGG
CGACACCGATGCGAAATGCCCGACCGAAATCGGCATCACCGACCGGCGCGAGTTCGAGCTTTCCAATCTC
GGCTTCCTGCCGCTCTGCCACTACAAGAACACCGACTATGCCGTGTTCTTCGGCGCCCAGTCGGTGCAGA
AGCCGAAGAAATACGACCGGCCGGACGCCACCGCTAACGCCGCGATCTCCGCTCGCCTGCCCTACATCAT
GGCCTCCTCCCGCTTCGCGCATTTCCTCAAGGTGATGGCGCGCGACAAGATCGGCTCCTTCATGGAGGCG
AAGGACTGCGAGAATTGGCTGAACCGCTGGATCGGCAACTATGTCAACGCCAACCCCGATGCCGGCCAGG
AAATGAAGGCCCGATATCCGCTGCGCGAGGCCAAGGTCGAGGTCAAGGAGATCCCGGGTAAGCCCGGCTC
CTACAACGCGGTGGCCTATCTGCGTCCCTGGCTGCAGATGGAGGAACTGACGACCTCGATGCGGATGGTC
GCTCGGATCCCGCAGAAGGCCTGA