SecReT6
Protein ID: 326405565
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34180
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3716000..3716506 [-]
Producttype VI secretion system family protein
NoteTssB
UniProt IDF0IXK0
KEGG IDamv:ACMV_34180
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-63, Aligned region: 9..163
Protein Sequence: 168 a.a.     [Download]
>gi|326405565|ref|YP_004285647.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MSGSIHEKLNRVRKPRVHITYDVETDGAQIARELPFVMGVMGDFSGDPTQPLKPLSERKFVQIDRDNFND
VMARMAPGLKLKVDNTLADDGTQMAVDLKFNSIEDFDPERVVEQVPALKSLLETRNKLRDLMSKADRSEE
LESLLEQVLQNEAELKSLSGELGLGKEG
 
Nucleotide Sequence: 507 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c3716506-3716000 Acidiphilium multivorum AIU301, complete genome
ATGAGTGGCAGTATCCACGAGAAACTCAACCGCGTACGGAAGCCGCGCGTGCACATTACCTACGATGTCG
AAACCGACGGCGCGCAGATCGCACGCGAACTGCCATTCGTGATGGGCGTGATGGGCGATTTCTCCGGCGA
CCCGACGCAGCCGCTGAAGCCGCTGTCGGAGCGGAAATTCGTCCAGATCGACCGCGACAACTTCAACGAT
GTCATGGCCCGCATGGCGCCCGGCCTGAAGCTGAAGGTGGACAACACCCTGGCCGATGACGGCACGCAGA
TGGCGGTTGACCTGAAATTCAACAGCATCGAGGATTTCGATCCCGAGCGTGTCGTCGAGCAGGTTCCTGC
CCTCAAATCCTTGCTGGAGACGCGCAACAAGCTGCGCGACCTGATGAGCAAGGCCGATCGATCGGAAGAA
CTTGAGTCGCTGCTTGAACAGGTTCTTCAGAATGAAGCCGAACTGAAATCGCTCTCGGGCGAACTCGGCC
TCGGCAAGGAGGGCTGA