SecReT6
Protein ID: 326405566
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34190
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3716834..3717649 [+]
ProductImpE family protein
NoteTagJ
UniProt IDF0IXK1
KEGG IDamv:ACMV_34190
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.80E-36, Aligned region: 147..270
TPR_19 [PF14559], Evalue: 1.80E-07, Aligned region: 16..72
TPR_19 [PF14559], Evalue: 1.80E-07, Aligned region: 106..134
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 15..73
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 101..135
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 15..49
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 42..73
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 110..137
Protein Sequence: 271 a.a.     [Download]
>gi|326405566|ref|YP_004285648.1| ImpE family protein [Acidiphilium multivorum AIU301]
MADGAAKSDDSGVGALFRAGRLDDAIAAATAKVKSSPSDLSARVLLAELLVFAGNIERADVLLDAAGQLD
PSASIVVAEFRQLLRAETARRQLYRDGRVPEFLGGPGDVETALLAALVALRDGDAEAARRAAETAEAGRG
ARAGTADGSAFADFRDASDICGGIFEVLTTTGKYFWIPISRVTEVTFHPPERPRDLIWRRATLAVHDGPD
GDVYMPVTYAAGDASLAPEFRLGRATDWIEQGGLVTGVGQREFLVGEAAVPVMELGEIVFS
 
Nucleotide Sequence: 816 bp     [Download]
>gi|326402148|ref|NC_015186.1|:3716834-3717649 Acidiphilium multivorum AIU301, complete genome
ATGGCGGATGGCGCAGCAAAGAGCGACGATTCCGGCGTGGGCGCGCTGTTCCGTGCCGGGCGCCTCGATG
ATGCGATCGCGGCTGCAACGGCGAAGGTGAAGTCCAGCCCGTCGGATCTGTCGGCGCGGGTGCTGCTCGC
CGAACTCCTTGTCTTCGCCGGCAATATCGAGCGCGCCGATGTCCTGCTCGATGCCGCGGGCCAGCTTGAC
CCGAGTGCAAGCATCGTTGTTGCCGAATTCCGCCAGCTTCTCCGTGCCGAGACGGCGCGCCGGCAATTGT
ATCGTGACGGGCGAGTGCCTGAGTTCCTCGGCGGACCGGGCGATGTCGAAACAGCACTTCTGGCGGCCCT
GGTCGCGTTGCGTGACGGCGATGCCGAGGCGGCGAGGCGCGCGGCGGAGACAGCCGAGGCCGGACGCGGC
GCGCGGGCCGGAACTGCCGACGGGAGCGCCTTCGCGGATTTCCGCGATGCCAGCGACATCTGCGGCGGGA
TTTTCGAAGTTCTGACCACGACCGGGAAATATTTCTGGATCCCGATTTCGCGCGTGACGGAGGTGACCTT
TCATCCGCCGGAGCGGCCGCGCGACCTGATCTGGCGGCGCGCGACGCTTGCGGTGCATGACGGGCCCGAT
GGCGACGTCTACATGCCGGTGACCTATGCGGCGGGCGATGCGTCGCTCGCCCCCGAATTCCGGCTTGGAC
GGGCGACGGACTGGATCGAACAGGGCGGCCTTGTGACCGGTGTTGGTCAGCGTGAGTTCCTGGTCGGCGA
GGCGGCCGTGCCCGTAATGGAGCTTGGCGAGATCGTGTTCTCCTGA