SecReT6
Protein ID: 326405567
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34200
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3717649..3718170 [+]
Producttype VI secretion system family protein
NoteTssE
UniProt IDF0IXK2
KEGG IDamv:ACMV_34200
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-20, Aligned region: 47..151
Protein Sequence: 173 a.a.     [Download]
>gi|326405567|ref|YP_004285649.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MSGPIGFSDRVRDAGARVQLSLLDRLLDDEPDRDRDRPLSAGEALNMLRRSVRRDLEALLNAKRRWRALP
PALAELRNSIAGYGLPDYTAGSMSATGAREAFRAEVERTIRQFEPRFARVSVTLVKAENPLDPTLYMRIE
GLLHAEPAPEPISFNTVVDSTSAEIEVKGEGGV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|326402148|ref|NC_015186.1|:3717649-3718170 Acidiphilium multivorum AIU301, complete genome
ATGAGCGGCCCGATCGGCTTCAGCGACCGGGTGCGCGACGCGGGCGCGCGGGTACAACTGTCGCTGCTCG
ACCGATTGCTGGACGATGAACCCGATCGCGATCGGGATCGGCCGCTGTCCGCCGGCGAAGCGCTCAACAT
GCTGCGCCGGTCGGTACGCCGCGACCTTGAGGCGCTGTTGAATGCGAAGCGCCGCTGGCGTGCATTGCCG
CCGGCGCTGGCAGAGCTGCGCAACTCGATCGCAGGCTACGGACTGCCGGACTATACCGCCGGCAGCATGA
GCGCCACAGGCGCGCGCGAGGCGTTCCGCGCGGAAGTCGAACGCACGATCCGCCAGTTCGAGCCGCGATT
TGCCCGCGTCTCGGTGACGCTCGTCAAGGCCGAGAACCCATTGGACCCCACGCTCTACATGCGGATCGAG
GGGCTGCTGCATGCCGAGCCGGCACCTGAGCCGATCAGTTTCAACACTGTGGTCGACTCAACCTCGGCCG
AGATCGAGGTGAAGGGGGAAGGCGGTGTCTGA