SecReT6
Protein ID: 326405568
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34210
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3718163..3719980 [+]
Producttype VI secretion system family protein
NoteTssF
UniProt IDF0IXK3
KEGG IDamv:ACMV_34210
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.50E-192, Aligned region: 5..605
Protein Sequence: 605 a.a.     [Download]
>gi|326405568|ref|YP_004285650.1| type VI secretion system family protein [Acidiphilium multivorum AIU301]
MSDRLLPYFNRELVAIRKLAGEFADAHPKIAGRLRLSPDAIDDPHVARLLDGVAYLSARVHQRLDDEFPE
LTDALLSALYPGFLAPVPSSAIVQFTPKADLQGGAEIDAGFAIETERVRGHPCRFRTAYPVTLWPVRIAQ
ARLSGQPFVAPANPLAAGAASVLRIVVETMAPDMTFAKLGMDRLRLFLRGGPAIAPHLHEMLAAHVIGVA
LAEAPGDPAPVLLDPASVRPVGFADDEALLPWPARGFAGFRLLTEYFAFSDKFRFFDIDGLDRRTLVLDR
NRLEIFIYFDRSMTELERALGTEHLALGCTPMVNIFPQRCEPIRLDQTETEYRVIPDARGVGAFEVWGIT
AVTQTDAAGNTAPWLPFYRVGRVEDSEVGGQYLEARRPAPVAVGGTETFIAPFGADFDAHAPGDKVLSVE
AMCLNRDLPAALPFGGGHPVLTALSPHDGIAGIACLTPPGATLRPDLAERGAWRLISHLSLGHLSVVGGA
EGAAALRDVLRLYDRAGTAETRGAIEALVAVTARPGTARVPGGRAGSFCRGLDIALEFESKAYHDNGLFL
LGAVLERFLALHGTINSFVRTTLRLRGRIDPVKRFPPRAGYRTLL
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|326402148|ref|NC_015186.1|:3718163-3719980 Acidiphilium multivorum AIU301, complete genome
GTGTCTGACCGGCTGCTGCCGTATTTCAACCGCGAACTGGTGGCGATCCGCAAGCTGGCCGGCGAGTTCG
CGGATGCGCACCCCAAGATCGCCGGCCGCTTGCGGCTTTCGCCCGACGCGATCGACGACCCCCATGTGGC
GCGGCTGCTCGACGGCGTCGCCTATCTCTCAGCGAGGGTGCATCAGCGGCTCGACGACGAGTTCCCCGAA
CTGACCGATGCGCTGCTTTCCGCCCTGTATCCGGGCTTCCTTGCGCCCGTGCCATCGAGCGCGATCGTCC
AGTTCACTCCCAAGGCGGATCTGCAGGGCGGAGCGGAGATCGACGCTGGCTTTGCGATCGAGACCGAGCG
GGTTCGCGGCCATCCCTGCCGGTTCCGTACCGCCTATCCGGTGACGCTATGGCCGGTGCGGATTGCCCAG
GCGCGCCTTTCGGGACAGCCTTTCGTGGCGCCCGCCAATCCGCTCGCCGCCGGCGCTGCCTCGGTTCTGC
GGATCGTGGTCGAGACGATGGCGCCGGACATGACCTTCGCGAAGCTGGGGATGGACCGGCTGCGCCTGTT
CCTCCGCGGCGGCCCGGCGATTGCGCCGCATCTGCATGAAATGCTCGCCGCGCACGTGATCGGCGTCGCG
CTTGCCGAGGCGCCGGGCGATCCGGCGCCGGTGCTGCTCGATCCGGCTTCGGTGCGCCCGGTCGGCTTTG
CCGATGACGAGGCGCTGTTGCCCTGGCCGGCGCGCGGCTTCGCCGGATTCCGGCTGCTAACCGAATATTT
CGCCTTCTCCGACAAGTTCCGCTTTTTCGACATCGATGGTCTCGATCGGCGCACACTCGTGCTTGATCGG
AACAGACTCGAAATCTTCATCTATTTTGATCGCTCGATGACCGAACTGGAACGAGCGTTGGGCACCGAAC
ATCTCGCGCTCGGTTGCACGCCGATGGTCAATATCTTTCCACAGCGCTGCGAACCGATCCGGCTCGACCA
GACCGAGACGGAATATCGGGTGATTCCGGATGCCAGGGGGGTTGGTGCCTTCGAGGTGTGGGGAATCACC
GCGGTGACCCAAACCGATGCTGCCGGCAACACCGCGCCGTGGTTGCCATTCTATCGCGTCGGGCGGGTCG
AGGACAGCGAGGTGGGTGGTCAGTATCTGGAGGCGCGGCGGCCGGCACCGGTCGCGGTGGGCGGTACCGA
GACGTTTATCGCGCCGTTCGGCGCCGATTTCGATGCGCATGCGCCGGGCGACAAGGTGCTTTCGGTCGAG
GCGATGTGCCTGAACCGCGACCTGCCGGCGGCCCTGCCGTTCGGCGGCGGCCATCCCGTGCTGACGGCAT
TGTCGCCACATGACGGCATCGCGGGCATCGCCTGTCTGACGCCGCCTGGCGCGACGCTTCGGCCGGACCT
CGCCGAACGCGGCGCGTGGCGGCTGATTTCGCACCTGTCGCTCGGCCATCTTTCGGTCGTCGGCGGCGCC
GAAGGAGCGGCTGCGTTGCGTGACGTGCTGCGCCTCTACGACCGGGCAGGCACCGCCGAGACGCGCGGTG
CGATCGAAGCGCTGGTCGCGGTAACGGCGCGGCCTGGCACGGCCCGGGTGCCGGGTGGCCGGGCAGGCAG
TTTCTGCCGCGGGCTTGATATCGCGCTCGAATTCGAGTCGAAAGCGTATCACGACAATGGGCTGTTCCTG
CTCGGAGCCGTTCTTGAGCGGTTCCTCGCGCTGCATGGCACGATCAATTCCTTCGTCCGCACCACCCTGC
GCTTGCGCGGGCGGATCGATCCGGTGAAGCGCTTTCCGCCCCGCGCCGGCTACCGGACGCTGCTGTGA