SecReT6
Protein ID: 326405569
SecReT6 ID426
T6SS typei5
Gene symbol-
Locus tagACMV_34220
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]3719977..3721086 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0IXK4
KEGG IDamv:ACMV_34220
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-78, Aligned region: 23..331
Protein Sequence: 369 a.a.     [Download]
>gi|326405569|ref|YP_004285651.1| hypothetical protein ACMV_34220 [Acidiphilium multivorum AIU301]
MNRPADSHRRRRTPIGVLDRLTAEPWHFRFGAAVRLLWLASGRSDPGDAIRFTTPLSLGHPAAEIDEAEA
PAPDEPRGRIATRLIGLLGASSPLPRWYTELVAGANRARSPATAAFFDLLSQRIISAFAVAGTKYRPHLA
AEVARHTGAADHGSADPAERALLALTGYGSPDLVGRLTAGRGSILHYAGFFATWPRSASRLEAMLSDWLE
RPVEIIEFAGAWLRIGPDEQSRMPRGRLPGQFNRLGMDCAAGARAYDQQARFVIRIGPLSRAAFAALLPD
RPLLRELVSLVRAYVGMEVDFAVNLVLDPADVPSLRLGGPDAPRLSWTGWLPAPAAAMSGGRKADQAMFA
AGSIEALPALDPALARRAA
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|326402148|ref|NC_015186.1|:3719977-3721086 Acidiphilium multivorum AIU301, complete genome
GTGAACCGACCGGCGGACAGCCACCGGCGCCGGCGGACGCCAATCGGCGTGCTCGACCGGCTGACTGCCG
AGCCCTGGCACTTTCGTTTCGGCGCTGCGGTCCGGCTGCTTTGGCTGGCCTCGGGGCGAAGCGATCCTGG
CGACGCGATACGCTTCACCACCCCACTGTCCCTCGGCCATCCGGCCGCCGAAATCGATGAGGCCGAGGCG
CCCGCTCCCGACGAGCCGCGAGGCCGGATTGCGACACGGCTCATCGGCCTGCTGGGCGCATCGAGCCCCT
TGCCCCGCTGGTATACCGAACTCGTCGCCGGCGCGAACCGCGCCCGCTCACCGGCGACGGCAGCCTTCTT
CGACCTTCTCTCGCAGCGCATCATCTCGGCTTTCGCGGTCGCCGGAACAAAGTATCGCCCGCATCTTGCC
GCCGAGGTCGCGCGGCACACCGGGGCAGCGGACCATGGGTCGGCCGATCCGGCCGAGCGCGCGCTGCTTG
CGCTGACCGGCTATGGTTCGCCGGACCTGGTCGGCCGGCTGACGGCGGGTCGGGGTTCGATCCTGCATTA
TGCAGGTTTTTTCGCAACCTGGCCGCGTTCGGCCAGCCGGCTTGAGGCGATGCTGAGCGATTGGCTGGAA
CGGCCGGTCGAGATCATCGAATTTGCCGGCGCATGGCTCAGGATCGGGCCTGATGAGCAGAGCCGGATGC
CGCGTGGCAGGCTTCCCGGCCAGTTCAACCGCCTGGGTATGGACTGCGCCGCCGGCGCCAGGGCCTATGA
CCAGCAGGCACGTTTCGTTATCCGCATTGGCCCGCTGTCGCGCGCTGCCTTCGCGGCGCTGCTGCCCGAC
CGGCCGCTGCTGCGCGAGCTTGTGTCGCTGGTGCGGGCGTATGTCGGCATGGAGGTGGATTTTGCCGTGA
ATCTTGTACTGGATCCTGCTGACGTTCCGTCATTACGGCTTGGCGGCCCCGATGCGCCACGCCTGTCCTG
GACCGGGTGGCTGCCCGCACCCGCCGCAGCGATGAGCGGGGGCCGAAAGGCCGATCAGGCGATGTTCGCG
GCCGGATCGATCGAGGCCTTGCCGGCGCTCGACCCCGCTTTGGCGCGGAGAGCCGCATGA