SecReT6
Protein ID: 326796892
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3664
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4043561..4045627 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF2JVY8
KEGG IDmme:Marme_3664
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-39, Aligned region: 46..345
Phage_base_V [PF04717], Evalue: 3.20E-13, Aligned region: 317..330
Phage_base_V [PF04717], Evalue: 3.20E-13, Aligned region: 395..465
Phage_base_V [PF04717], Evalue: 3.20E-13, Aligned region: 516..530
DUF2345 [PF10106], Evalue: 8.60E-09, Aligned region: 521..564
DUF2345 [PF10106], Evalue: 8.60E-09, Aligned region: 563..684
T6SS_Vgr [PF13296], Evalue: 0.0012, Aligned region: 480..511
T6SS_Vgr [PF13296], Evalue: 0.0012, Aligned region: 506..565
Protein Sequence: 688 a.a.     [Download]
>gi|326796892|ref|YP_004314712.1| Rhs element Vgr protein [Marinomonas mediterranea MMB-1]
MDFSVSDIRQKFKEYGAADASQYFLSLADLPQDQFMVLSFALDEWGFNQGYQITVKVVSVEAIDVALVMN
KKARFHVFSNGMLRPVHGLVSACRLTGTLTTGFTEYTLTISSVLSLLAEQQHNRVFTDKSALNIAKDVLK
QDLNGVAQVEAQCSDTEVLSLCIQYQESDLDFVIRILAKEGVFLNVIQGEGLTQVQLCDRVTQTSQSDSA
LVLPLLENIGAAKERDHIYKLDSHARRMPTSLELNDSYPWHSQNLLVNESVNAHSSDESSSLKTELWALN
YSTPNKGKQLAKRFLMAKESQHNYFLFESNCRTIAPGVLVDVLSPSGDAAGQYRVLEVSLSGSQGDLIAN
GSDSNSKGFRCRFIAVKADSEFTPEFVPRAPVHLALSAMTTSELDDKGCYRIRFGFDRRSESEGASSPPI
RLAQPLGGKEQGMHFPLAIGTLVSVQFENGDIERPIIQGCIQSQDSVVLVNSENANHNMIQTRGGHSLLF
DDSSDNEKIQLATPDQKNSLVLDASSNGHRVSLDSSEGDIQLSAGKSTLIKSGEAQTYEAGQNFSINANT
TFEVMTQESDVVIQSATTLEQTSAQSMRLQSREGAVSITSEGAMSMQTANGLNQIVDEGNYQIQVQDGSY
QLSTENGITLNSQGSTISLTQGDAAIELNGSGSLVLSGSQIEISADSVSVKGGSIANN
 
Nucleotide Sequence: 2067 bp     [Download]
>ref|NC_015276.1|:c4045627-4043561 Rhs element Vgr protein [Marinomonas mediterranea MMB-1]
ATGGACTTTTCTGTTTCCGATATAAGGCAAAAATTTAAAGAGTATGGTGCTGCTGATGCGAGTCAATACT
TCTTGTCTCTTGCAGACCTTCCACAAGATCAGTTTATGGTGTTGTCATTTGCACTTGATGAGTGGGGGTT
TAATCAGGGCTACCAAATTACGGTAAAGGTCGTGAGTGTTGAGGCGATTGATGTCGCGCTGGTGATGAAT
AAAAAGGCTAGGTTCCACGTTTTCAGTAATGGGATGTTACGTCCTGTTCATGGCCTAGTGTCCGCGTGTC
GGCTGACGGGAACTTTAACGACAGGGTTTACGGAATATACTCTGACTATCTCATCGGTCTTATCGTTATT
GGCGGAACAACAGCACAACCGAGTCTTTACTGACAAGAGTGCATTAAACATCGCGAAAGACGTTCTAAAG
CAAGATTTAAATGGCGTTGCTCAGGTCGAGGCGCAATGCTCTGATACAGAGGTTTTGTCACTTTGTATTC
AGTATCAAGAAAGCGATCTAGACTTTGTTATCCGAATTTTAGCGAAAGAAGGCGTGTTTCTGAATGTCAT
ACAAGGAGAAGGGCTAACGCAAGTTCAGTTGTGTGACCGAGTGACGCAAACGTCGCAAAGTGACAGCGCA
TTAGTCTTGCCGCTATTAGAAAATATCGGCGCAGCAAAAGAGCGTGATCACATCTATAAGTTAGACAGCC
ATGCTAGAAGAATGCCGACTAGCCTAGAGTTGAATGATTCCTACCCTTGGCATAGTCAGAATCTCCTTGT
GAACGAATCGGTCAACGCTCATTCGTCGGATGAGAGCAGCTCGCTTAAAACGGAACTTTGGGCGTTGAAC
TATTCGACGCCGAATAAAGGCAAGCAACTTGCTAAACGTTTTTTAATGGCAAAAGAGAGCCAGCATAATT
ACTTTCTGTTTGAATCAAATTGCCGAACCATTGCTCCAGGCGTCTTGGTCGATGTACTAAGCCCATCGGG
AGACGCCGCAGGTCAATACCGCGTTTTGGAAGTGTCGCTTTCAGGTTCTCAAGGTGATTTGATTGCCAAC
GGTTCTGATTCCAATTCAAAAGGGTTTCGCTGTCGATTCATTGCCGTCAAGGCAGATTCAGAATTCACAC
CTGAATTTGTTCCTCGTGCACCAGTGCACTTAGCGCTGAGTGCGATGACAACCAGTGAGCTTGACGACAA
AGGTTGTTACCGAATTCGATTTGGGTTTGATCGACGATCAGAGTCAGAGGGCGCATCAAGTCCCCCAATA
CGGCTCGCTCAGCCGCTGGGTGGGAAAGAGCAGGGGATGCATTTCCCTCTTGCTATTGGCACCCTTGTTT
CTGTGCAGTTTGAGAATGGAGACATAGAGCGCCCAATCATTCAAGGTTGTATTCAATCGCAGGACTCGGT
TGTGTTGGTGAACAGTGAGAATGCCAATCACAATATGATCCAAACTCGTGGGGGACACTCTCTACTATTT
GACGATAGTAGCGACAATGAAAAAATTCAGTTGGCCACACCCGACCAGAAAAATTCGCTCGTACTCGATG
CTTCGAGCAACGGTCATCGCGTTTCTCTTGATTCGAGCGAGGGAGATATCCAGCTCAGTGCTGGCAAATC
TACATTGATTAAAAGTGGAGAGGCGCAGACCTATGAAGCAGGACAAAACTTCTCTATTAATGCTAACACC
ACGTTTGAAGTGATGACGCAAGAGTCCGACGTTGTGATCCAATCCGCCACGACGCTCGAACAAACATCCG
CTCAAAGTATGCGATTGCAAAGCCGTGAAGGTGCTGTATCCATTACCAGTGAAGGTGCCATGTCGATGCA
AACTGCGAATGGTTTAAATCAAATTGTGGACGAAGGTAATTATCAAATCCAAGTTCAAGATGGCAGTTAT
CAGCTCTCAACGGAAAATGGCATCACGCTAAATAGCCAAGGCTCGACGATTAGCTTAACCCAAGGCGACG
CTGCTATTGAGCTGAATGGCTCGGGTAGTCTTGTCTTAAGTGGCTCTCAAATTGAAATAAGTGCCGACAG
TGTGTCAGTCAAAGGGGGAAGCATCGCCAACAATTAA