SecReT6
Protein ID: 326796893
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3665
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4045630..4048554 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF2JVY9
KEGG IDmme:Marme_3665
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 41..52
AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 252..329
AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 632..852
AAA [PF00004], Evalue: 7.20E-22, Aligned region: 254..384
AAA [PF00004], Evalue: 7.20E-22, Aligned region: 637..767
AAA [PF00004], Evalue: 7.20E-22, Aligned region: 925..957
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 254..274
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 327..383
AAA_5 [PF07728], Evalue: 1.60E-15, Aligned region: 636..755
ClpB_D2-small [PF10431], Evalue: 8.60E-14, Aligned region: 397..424
ClpB_D2-small [PF10431], Evalue: 8.60E-14, Aligned region: 860..931
AAA_16 [PF13191], Evalue: 4.90E-10, Aligned region: 232..289
AAA_16 [PF13191], Evalue: 4.90E-10, Aligned region: 299..333
AAA_16 [PF13191], Evalue: 4.90E-10, Aligned region: 504..519
AAA_16 [PF13191], Evalue: 4.90E-10, Aligned region: 625..680
AAA_16 [PF13191], Evalue: 4.90E-10, Aligned region: 831..888
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 45..85
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 253..334
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 370..417
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 633..658
AAA_17 [PF13207], Evalue: 7.70E-09, Aligned region: 254..300
AAA_17 [PF13207], Evalue: 7.70E-09, Aligned region: 470..510
AAA_17 [PF13207], Evalue: 7.70E-09, Aligned region: 636..674
Sigma54_activat [PF00158], Evalue: 6.30E-08, Aligned region: 249..274
Sigma54_activat [PF00158], Evalue: 6.30E-08, Aligned region: 635..754
AAA_14 [PF13173], Evalue: 7.00E-08, Aligned region: 254..356
AAA_14 [PF13173], Evalue: 7.00E-08, Aligned region: 489..528
AAA_14 [PF13173], Evalue: 7.00E-08, Aligned region: 634..718
AAA_19 [PF13245], Evalue: 1.30E-07, Aligned region: 251..274
AAA_19 [PF13245], Evalue: 1.30E-07, Aligned region: 632..660
Zeta_toxin [PF06414], Evalue: 6.90E-07, Aligned region: 254..274
Zeta_toxin [PF06414], Evalue: 6.90E-07, Aligned region: 633..676
AAA_18 [PF13238], Evalue: 2.40E-06, Aligned region: 254..284
AAA_18 [PF13238], Evalue: 2.40E-06, Aligned region: 507..534
AAA_18 [PF13238], Evalue: 2.40E-06, Aligned region: 637..666
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 248..313
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 624..657
Arch_ATPase [PF01637], Evalue: 4.20E-05, Aligned region: 233..274
Arch_ATPase [PF01637], Evalue: 4.20E-05, Aligned region: 307..424
Arch_ATPase [PF01637], Evalue: 4.20E-05, Aligned region: 493..538
Arch_ATPase [PF01637], Evalue: 4.20E-05, Aligned region: 629..677
RNA_helicase [PF00910], Evalue: 4.60E-05, Aligned region: 255..275
RNA_helicase [PF00910], Evalue: 4.60E-05, Aligned region: 637..660
AAA_25 [PF13481], Evalue: 6.60E-05, Aligned region: 254..314
AAA_25 [PF13481], Evalue: 6.60E-05, Aligned region: 632..658
NACHT [PF05729], Evalue: 0.00017, Aligned region: 254..281
NACHT [PF05729], Evalue: 0.00017, Aligned region: 636..657
SRP54 [PF00448], Evalue: 0.0002, Aligned region: 254..274
SRP54 [PF00448], Evalue: 0.0002, Aligned region: 635..682
T2SE [PF00437], Evalue: 0.0014, Aligned region: 239..275
T2SE [PF00437], Evalue: 0.0014, Aligned region: 619..714
MobB [PF03205], Evalue: 0.0015, Aligned region: 255..278
MobB [PF03205], Evalue: 0.0015, Aligned region: 636..667
AAA_33 [PF13671], Evalue: 0.0019, Aligned region: 254..272
AAA_33 [PF13671], Evalue: 0.0019, Aligned region: 635..664
NTPase_1 [PF03266], Evalue: 0.0024, Aligned region: 254..276
NTPase_1 [PF03266], Evalue: 0.0024, Aligned region: 636..660
AAA_11 [PF13086], Evalue: 0.0033, Aligned region: 252..538
AAA_11 [PF13086], Evalue: 0.0033, Aligned region: 632..747
UPF0079 [PF02367], Evalue: 0.0046, Aligned region: 254..274
UPF0079 [PF02367], Evalue: 0.0046, Aligned region: 634..662
Clp_N [PF02861], Evalue: 0.0059, Aligned region: 25..49
AAA_30 [PF13604], Evalue: 0.0074, Aligned region: 241..274
AAA_30 [PF13604], Evalue: 0.0074, Aligned region: 627..665
Mg_chelatase [PF01078], Evalue: 0.0074, Aligned region: 237..289
Mg_chelatase [PF01078], Evalue: 0.0074, Aligned region: 636..658
RuvB_N [PF05496], Evalue: 0.0089, Aligned region: 254..272
RuvB_N [PF05496], Evalue: 0.0089, Aligned region: 323..334
RuvB_N [PF05496], Evalue: 0.0089, Aligned region: 604..657
Protein Sequence: 974 a.a.     [Download]
>gi|326796893|ref|YP_004314713.1| type VI secretion ATPase, ClpV1 family [Marinomonas mediterranea MMB-1]
MDSQTLKVLIDKLSPLCGRALEAAAGFANSRGHREIVPEHLLLKLLEESEVKGEASHLSCVLSYFSVDQN
TLWQQLVDNVNQQRVLHDSKAVLSSELYELLERACLNFTLRMPSKASWVRQSDTVGIDSLSILESFIQIS
SNWPHYRSYDALRSINLDILKANVSEITVRSNEYEVDHFDQSISNSNDVGNVSLTEHGQGVGSGSAHSPR
AIDRFTTDLTIKAKNGELDPISGRHKEIRKAIDILCRRRKNNPILVGEPGVGKTAVVEGLAQRIVDGDVP
EFLKGKHIHVLDLGLLQAGASVKGEFEKRLKQVIDEVGSSDEIMLFIDEAHTLVGAGGEAGLADAANLLK
PALARGELRTVAATTWSEYKQYFERDPALARRFQMVKVEEPTLDAAKHMLTQIKEKYEQHHDVSITDEAI
EAAVELSDRYVSGRFLPDKAIDLIDTAAARVKMGQAVLPQTLEGLQAKALYIEDRIAGLEKELDQGLESN
MDLHHELKDEQQQVLLEISDLKESWDKQNHLVEEIQRSVENAENDEESKHRAYSLRKLLQEEQESSSAGL
CIQAEVNATSIADVIADWTGIPVGSMVRDDLQNLLTFDAALGEDIIGQDGAIRAIGQSLRANKAKLRFTE
GPQGVFLLAGPSGVGKTETAKKIAKHLFGSERSLITINMSEYQEAHTVSQLKGSPPGYVGYGQGGLLTEA
VRQKPYSVVLLDEVEKAHVDVMNVFYQVFDQGIMRDGEGREIDFKNTIILMTSNLGSELIMEAMSDRNEN
SESDDVDLSFSENETLKSDDSVANSAITDVSGGGNERDSSDDDKGENDDGKIEYTPPSTLELEALIQPTV
AQHFAPALAARMQIVPFVSLNEESLKAIVTHKLDKLAERLMSEYKMELRCDESALDMLLSLCQESHAGAR
LINQRIESLLSSRIANEILHYLVESDLPDILQMTASENGTIDVVFLDKQAGGQQNALLDDSIEA
 
Nucleotide Sequence: 2925 bp     [Download]
>ref|NC_015276.1|:c4048554-4045630 type VI secretion ATPase, ClpV1 family [Marinomonas mediterranea MMB-1]
ATGGACAGTCAAACACTGAAAGTCTTGATCGACAAGTTAAGCCCATTATGTGGTCGAGCGCTGGAAGCCG
CCGCCGGTTTTGCAAACTCTAGAGGACACAGAGAAATCGTTCCGGAACACCTGTTGCTAAAGCTACTAGA
AGAAAGCGAAGTAAAGGGCGAAGCCAGTCATCTATCGTGTGTATTGAGCTACTTTTCAGTCGATCAAAAT
ACGTTATGGCAGCAGCTTGTTGATAATGTGAATCAGCAAAGAGTGCTTCATGACAGTAAAGCCGTTTTGT
CTTCCGAGCTATATGAACTACTCGAACGCGCTTGTTTGAATTTTACACTGCGCATGCCATCAAAAGCTTC
TTGGGTTCGCCAAAGCGATACCGTCGGTATTGATTCATTGAGCATTCTTGAAAGCTTTATTCAAATCTCC
TCTAACTGGCCTCACTATAGAAGTTACGATGCGCTGAGAAGCATTAACCTAGATATTCTGAAAGCAAATG
TCAGTGAGATCACTGTACGCTCAAACGAATACGAGGTGGACCATTTCGATCAAAGTATCTCTAACAGTAA
CGATGTGGGGAATGTGAGTTTAACCGAACATGGTCAGGGCGTAGGTTCGGGTTCTGCTCACTCTCCAAGA
GCCATCGATCGATTTACAACAGACCTGACGATCAAGGCTAAAAACGGTGAATTAGATCCCATCAGCGGCC
GCCATAAAGAGATTCGAAAAGCCATTGATATCCTCTGTCGTAGGCGAAAAAATAACCCTATTTTGGTTGG
TGAGCCGGGTGTCGGTAAAACGGCGGTCGTTGAAGGGCTAGCGCAACGCATTGTCGACGGAGATGTGCCT
GAGTTCTTAAAAGGTAAGCATATCCACGTACTTGATTTAGGTTTGTTGCAAGCGGGTGCAAGCGTTAAAG
GAGAGTTCGAAAAGCGTCTAAAGCAAGTGATTGACGAAGTGGGAAGCTCCGATGAGATCATGTTATTCAT
CGATGAAGCTCATACTTTGGTGGGAGCCGGCGGTGAAGCTGGGCTTGCCGATGCCGCAAATCTATTAAAG
CCAGCCTTAGCTCGCGGTGAGTTGAGAACCGTTGCGGCGACGACGTGGTCTGAATATAAGCAGTACTTTG
AACGAGATCCCGCTCTGGCGCGCCGCTTCCAGATGGTTAAAGTGGAAGAACCCACATTGGATGCTGCCAA
GCACATGCTGACGCAAATTAAAGAGAAGTACGAGCAGCATCATGATGTCAGCATTACAGACGAAGCAATT
GAGGCGGCAGTCGAACTGTCAGATCGTTATGTGAGTGGACGTTTTCTTCCAGATAAAGCGATCGATTTAA
TTGATACTGCCGCTGCCCGTGTGAAAATGGGTCAGGCCGTTTTGCCTCAAACCCTAGAAGGACTTCAAGC
AAAAGCGCTTTATATTGAAGACCGAATAGCAGGGCTAGAGAAGGAGCTCGACCAAGGGCTCGAAAGCAAT
ATGGATTTACACCACGAGTTAAAAGATGAACAACAGCAAGTCCTGTTGGAAATATCCGATCTAAAAGAAA
GTTGGGATAAGCAAAACCACCTTGTCGAAGAAATTCAACGCTCAGTTGAAAATGCGGAAAACGACGAGGA
AAGTAAGCATCGTGCATACTCTTTGAGAAAGCTGTTACAGGAAGAACAAGAGTCGTCATCGGCAGGCTTA
TGTATACAGGCGGAAGTCAATGCGACGTCCATTGCGGATGTAATTGCCGACTGGACTGGAATCCCTGTCG
GTAGCATGGTGCGAGATGACCTTCAAAATCTACTGACCTTTGACGCGGCTTTGGGTGAAGACATTATTGG
GCAAGACGGTGCGATCAGAGCGATTGGTCAGAGCCTTAGAGCGAATAAAGCGAAGCTTCGATTTACGGAA
GGGCCGCAAGGTGTCTTTTTATTGGCTGGCCCCAGTGGTGTTGGTAAAACGGAAACCGCCAAAAAAATTG
CAAAACACTTGTTTGGTAGTGAACGCTCACTTATCACGATTAATATGAGTGAGTACCAAGAAGCTCATAC
TGTTTCTCAATTAAAAGGCTCGCCTCCAGGCTATGTCGGTTATGGACAAGGTGGTTTGTTAACGGAAGCG
GTGCGTCAAAAGCCATATTCTGTCGTTTTACTCGACGAGGTAGAAAAAGCACACGTTGATGTTATGAACG
TCTTCTACCAAGTGTTTGATCAGGGCATTATGCGTGATGGTGAAGGAAGGGAAATCGACTTTAAAAACAC
CATTATACTCATGACTTCTAACTTAGGCTCTGAGCTTATTATGGAGGCAATGTCAGACAGAAACGAGAAT
TCAGAGAGCGATGATGTGGATTTGAGTTTCTCTGAAAATGAGACGCTAAAATCCGACGATTCAGTTGCTA
ATTCAGCAATCACTGACGTGAGTGGCGGTGGCAACGAACGCGATAGCTCTGACGATGACAAAGGTGAGAA
TGATGACGGAAAAATAGAATACACACCACCTTCAACGTTGGAACTGGAAGCACTGATTCAACCTACTGTT
GCTCAACACTTTGCTCCCGCATTAGCTGCTCGAATGCAGATCGTGCCCTTTGTTTCGCTTAATGAAGAGT
CATTAAAAGCCATTGTGACGCACAAGCTCGATAAGCTTGCTGAACGCTTAATGTCAGAGTACAAAATGGA
ATTGCGTTGTGACGAGTCTGCGCTCGATATGTTGTTGTCTTTGTGTCAGGAAAGTCACGCAGGGGCGCGT
TTAATCAACCAACGTATTGAATCCCTCTTATCCTCACGAATCGCCAATGAAATACTTCATTATCTAGTCG
AATCCGATTTGCCAGACATTCTACAAATGACGGCATCAGAAAATGGCACGATCGATGTGGTGTTTCTCGA
TAAGCAAGCTGGTGGTCAACAAAACGCCTTGCTTGATGATTCAATAGAGGCATAA