SecReT6
Protein ID: 326796894
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3666
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4048614..4049603 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDF2JVZ0
KEGG IDmme:Marme_3666
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-39, Aligned region: 16..311
Protein Sequence: 329 a.a.     [Download]
>gi|326796894|ref|YP_004314714.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MHRELDTHSLKASACEYHYHQLLNVLLKMKDQTQVRDKPSWLTLKPSDWLSFPASDVHKLTQGHNDNWQL
EATFFGLYGVDAPTPHYFLQDVTQNSEAGKCIAAFLDIFNQNAYWLLHKSWQKFQPLANAGNDNLFIKMC
LAISGRLPLPRSEYNKGSDGDAPSTVGQKGFSVGALSNRKKSLCVVENMLRHALSLPNLMVSSNLVKTVD
THQALPLGELLSLGDNTLLGSKVSVVGQAIKINLGVISLEHLEDFKPGGEKARYLASLLEDYLPTLVSYR
IGASVVVEGMPPMELSTKGQALKLGAPLVLGEAGQNIEYEFSDQSYQNF
 
Nucleotide Sequence: 990 bp     [Download]
>ref|NC_015276.1|:c4049603-4048614 type VI secretion protein [Marinomonas mediterranea MMB-1]
ATGCACAGAGAGTTAGATACTCATTCCCTTAAAGCGTCCGCCTGTGAGTACCACTATCATCAGTTGCTAA
ACGTACTGCTAAAGATGAAGGATCAAACGCAAGTCAGGGACAAACCTTCTTGGCTTACGTTGAAACCATC
TGACTGGTTATCCTTTCCTGCCTCTGATGTTCATAAGTTAACTCAAGGTCATAATGACAATTGGCAGTTA
GAGGCGACTTTTTTTGGTCTTTATGGGGTGGATGCTCCGACACCCCATTACTTTCTTCAAGATGTGACGC
AGAACTCAGAAGCCGGAAAGTGTATTGCGGCTTTCTTAGATATTTTTAATCAAAATGCCTATTGGTTGTT
GCACAAGAGCTGGCAAAAATTCCAGCCTCTCGCGAATGCAGGAAACGATAACCTCTTTATTAAAATGTGC
TTGGCAATATCCGGTCGATTGCCTCTTCCACGCAGTGAATATAACAAAGGCAGTGATGGCGATGCGCCTT
CAACAGTAGGGCAAAAAGGTTTTTCGGTTGGGGCGCTTTCTAACCGGAAAAAAAGCCTATGTGTTGTCGA
GAATATGCTTAGGCACGCTTTGTCTCTACCTAATTTAATGGTTTCTTCTAATTTAGTGAAAACCGTCGAT
ACGCATCAAGCGTTGCCTTTAGGGGAGTTGTTATCGTTAGGTGACAATACCTTACTTGGAAGCAAAGTCT
CGGTCGTTGGGCAGGCTATAAAGATCAACCTAGGTGTGATTAGTTTAGAACACTTGGAAGACTTTAAGCC
TGGGGGAGAGAAGGCGCGCTATTTGGCGTCTTTATTGGAAGATTACTTGCCGACTCTCGTTTCATACCGG
ATAGGGGCGAGTGTGGTGGTTGAAGGAATGCCGCCAATGGAACTAAGCACCAAAGGGCAAGCGCTTAAAC
TAGGCGCGCCATTGGTGTTAGGGGAAGCGGGGCAAAATATAGAGTATGAGTTCAGCGATCAAAGTTACCA
GAATTTTTAA