SecReT6
Protein ID: 326796895
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3667
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4049588..4051288 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDF2JVZ1
KEGG IDmme:Marme_3667
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-117, Aligned region: 2..562
Protein Sequence: 566 a.a.     [Download]
>gi|326796895|ref|YP_004314715.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MKEYFEAELRLLKEESQEFAKAYPEQAAMLNLNAVRDRDPYVERLLEGMAFLTSKIRERLDDSVPELSQS
LLDQLAPSLCRPFPSHLVLEFSPSALSGGLTNIPKGTVVSSPYKGPDSIKCHFQTTSNIELLPLHVHDIS
ATDVLGRGTKVTIELEKSADIAWADLQNQSLPIFLNCDRSLAYVLYEALTNSTATYATNLDGTLGKAKID
PCRIKVEANTLPAFEQGHDAYNILFDYFNARDRFMFVELCDIDYSLLSENAQRLSITIETALFLPPTHKV
DSKTLRINSVVGINTFPAESEPIKASSKYPDFLVKVDSEYGNQASSYWISEVASRDLKNGDVTEYKSLHK
LDYRSESDPTFMAQLKRSPTGKWQHYLSLNGSKDIDEQTLSVGLIATNNNYPRKYLDFGDVCELPSEIEQ
TISVRNISRPSKVSLPPSNQDFGWQLVSMLSQNLTVLDSANKLRALLGLFDWSGLEENKNRILSIDSVTQ
SRQQKIKKGVLFNIIQFDLTVSETGFSSTADIYFFGSILYAFLGAYADISERIEMKIMTLPSNKEWFWEA
NLCTES
 
Nucleotide Sequence: 1701 bp     [Download]
>ref|NC_015276.1|:c4051288-4049588 type VI secretion protein [Marinomonas mediterranea MMB-1]
GTGAAGGAATATTTTGAGGCGGAACTGCGCCTGTTAAAAGAAGAGTCGCAAGAGTTCGCAAAAGCGTATC
CAGAACAAGCGGCTATGTTGAACCTCAATGCGGTTCGAGATCGCGACCCGTATGTGGAACGACTGCTTGA
AGGGATGGCGTTTTTAACGTCAAAAATACGCGAACGATTAGATGATTCGGTTCCTGAACTTAGTCAAAGC
TTACTAGACCAGTTGGCGCCATCGTTATGTCGGCCCTTTCCATCGCATCTCGTCTTAGAGTTTTCTCCGT
CTGCGCTTTCGGGCGGCCTAACGAACATCCCAAAAGGAACGGTTGTCTCTTCTCCTTACAAAGGGCCAGA
CTCGATCAAGTGTCATTTTCAAACCACATCCAACATTGAATTGTTGCCTCTACACGTTCACGACATTTCT
GCGACGGACGTGCTTGGTCGAGGGACGAAAGTGACCATAGAGTTAGAAAAAAGTGCGGACATCGCCTGGG
CCGATTTACAGAATCAGAGCCTTCCTATTTTCTTAAATTGCGATCGCTCTCTTGCCTATGTGCTTTATGA
AGCATTAACAAACTCGACTGCCACCTACGCCACCAATCTAGATGGTACGTTAGGTAAAGCAAAAATTGAT
CCTTGCAGAATAAAGGTAGAGGCGAATACATTGCCCGCCTTCGAGCAGGGGCATGATGCCTACAACATTC
TTTTTGACTACTTCAATGCTCGTGATCGTTTTATGTTTGTTGAGCTTTGCGATATTGATTATTCCTTGCT
CTCTGAAAACGCTCAAAGGCTGTCCATTACGATAGAGACGGCATTATTTTTACCACCTACTCATAAAGTG
GATAGTAAAACTCTTCGTATCAACAGTGTTGTCGGAATTAATACTTTTCCAGCTGAGTCAGAACCGATTA
AGGCCAGTTCAAAATATCCAGATTTTTTAGTGAAAGTGGATAGTGAGTACGGTAATCAAGCAAGTTCTTA
CTGGATATCGGAGGTTGCCAGTCGGGACTTAAAAAACGGTGATGTGACAGAGTATAAGTCGCTTCATAAG
CTTGATTATCGCTCTGAGTCTGATCCCACGTTTATGGCACAACTGAAGAGAAGTCCAACTGGAAAGTGGC
AGCATTATCTCTCGTTGAATGGCTCAAAAGACATAGATGAGCAGACGTTGAGTGTTGGCCTGATTGCAAC
GAATAATAACTATCCAAGAAAATACTTGGACTTTGGCGATGTGTGCGAGTTGCCATCGGAGATAGAGCAA
ACAATATCGGTTCGTAATATTTCAAGACCAAGTAAGGTTTCATTACCGCCCTCAAATCAAGACTTTGGTT
GGCAGTTGGTTTCTATGCTCTCTCAAAATCTGACGGTGTTGGACAGTGCGAATAAACTTCGCGCTCTGCT
GGGTTTGTTCGATTGGAGTGGGCTTGAAGAAAATAAGAATAGAATTCTATCGATCGATAGTGTGACACAA
AGCCGCCAACAGAAGATAAAGAAAGGTGTTTTATTTAATATTATTCAATTTGATTTGACGGTCAGTGAGA
CGGGCTTTAGTTCAACGGCAGATATTTACTTTTTCGGCTCTATTCTCTATGCCTTTTTGGGCGCGTATGC
GGACATATCAGAGCGTATTGAGATGAAAATCATGACTCTACCATCAAATAAAGAGTGGTTCTGGGAAGCA
AATTTATGCACAGAGAGTTAG