SecReT6
Protein ID: 326796896
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3668
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4051316..4051747 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF2JVZ2
KEGG IDmme:Marme_3668
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-15, Aligned region: 26..112
Protein Sequence: 143 a.a.     [Download]
>gi|326796896|ref|YP_004314716.1| type VI secretion system lysozyme-like protein [Marinomonas mediterranea MMB-1]
MLSLYEVLSQQHMGGAQLSDFPTYEDYLMSIHDHLVRLLNARQGGLSHLPDYGMPDLNKLYQALPYSEDD
IAIAVKKIVEKYEPRLTGVHVIPLPRDLNSGVVSIRITGKTHNGNAISFKTNFKSSGTAEVAGPSSASNQ
YGY
 
Nucleotide Sequence: 432 bp     [Download]
>ref|NC_015276.1|:c4051747-4051316 type VI secretion system lysozyme-like protein [Marinomonas mediterranea MMB-1]
ATGTTGTCATTGTATGAAGTATTGAGCCAGCAACATATGGGTGGGGCGCAGTTAAGTGATTTTCCTACTT
ACGAAGATTATTTAATGAGCATTCACGATCATCTTGTTAGGCTCTTGAACGCTAGGCAGGGAGGTTTGTC
CCACTTACCCGATTACGGGATGCCTGACTTAAATAAGCTTTATCAGGCGTTACCTTACTCAGAAGATGAC
ATTGCGATTGCGGTTAAGAAAATCGTTGAAAAGTACGAACCTAGGCTGACGGGCGTCCATGTTATTCCTC
TTCCAAGAGATCTAAATTCCGGTGTGGTGTCGATTCGAATAACTGGAAAAACACATAACGGTAATGCGAT
TTCTTTTAAAACGAACTTTAAAAGTAGCGGAACCGCAGAGGTCGCTGGACCATCGAGTGCCTCAAATCAA
TATGGATATTAA