SecReT6
Protein ID: 326796898
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3670
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4052513..4054036 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDF2JVZ4
KEGG IDmme:Marme_3670
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.20E-177, Aligned region: 84..505
Protein Sequence: 507 a.a.     [Download]
>gi|326796898|ref|YP_004314718.1| type VI secretion protein EvpB [Marinomonas mediterranea MMB-1]
MSVQESVSTSAASVEFAEDSVYQRLCGLIQMEPVDAPVDINKFQNPKHMAEVETNERITAALKVFFELAL
ESGTQIERIDKTLLDQYIATIDDVISAQLDEVLHHKDFQKVESSWRGLKFLVDRTDFKANMKIELLDCTK
EALREDFEESPDTTQSGLFDQIYTQEYDTPGGEPVTSMIANFEFDRTGADVELLTEVSKVASAAHCPFIS
AIGPEFFDKESIEDIPKIQDIGTYMDRAEYIRWKGFRETEDSRYVGLVFPRFLLRLPYGEENPIRSFNYR
EGVTGEQHNRYLWGNSAFAFAANMTRSFKKNGWTVNIRGPESGGKLDKLPIHFYQSGRGTESKIPTEVLI
SETKELELADHGFIPLSYYKNSDYACFFSANSTQRPLECDEDADTANARINSRLPYIFLVSRIAQYLKIL
QRENIGSLKSRQDLENELNAWLQSLVTKMNNPEPELAATHPLKDGRVFVSESEDNPGYYFVNMHVQPHFQ
VEGVDVKLSLVSQMPEV
 
Nucleotide Sequence: 1524 bp     [Download]
>ref|NC_015276.1|:c4054036-4052513 type VI secretion protein EvpB [Marinomonas mediterranea MMB-1]
ATGTCTGTACAAGAAAGTGTATCTACAAGCGCTGCGAGTGTTGAGTTTGCAGAAGATTCTGTCTATCAAC
GATTGTGCGGCTTGATTCAAATGGAACCTGTTGACGCGCCAGTTGATATCAACAAATTTCAAAACCCGAA
ACATATGGCTGAAGTGGAGACAAACGAGCGAATCACTGCGGCGTTGAAGGTGTTTTTTGAACTTGCGCTA
GAGTCTGGCACACAGATAGAGAGAATTGATAAAACACTTCTTGATCAATATATCGCAACGATTGATGACG
TTATTAGTGCACAACTTGATGAAGTCTTGCATCACAAAGACTTCCAGAAAGTGGAATCGTCATGGCGTGG
TCTTAAGTTTTTAGTCGACCGTACTGACTTTAAAGCCAATATGAAAATTGAGCTACTGGACTGTACGAAA
GAGGCGCTACGAGAAGATTTTGAAGAGTCTCCAGACACGACTCAGTCAGGATTGTTTGATCAGATTTACA
CACAGGAATACGACACACCGGGTGGCGAACCTGTGACATCTATGATTGCCAACTTCGAATTCGACCGTAC
TGGTGCGGATGTGGAGTTGCTAACAGAAGTATCGAAAGTGGCGAGTGCCGCCCACTGTCCGTTTATCAGC
GCAATTGGCCCAGAATTCTTTGACAAAGAAAGCATAGAAGATATTCCAAAAATTCAAGATATCGGCACGT
ACATGGATCGCGCTGAGTACATTCGTTGGAAAGGTTTCCGAGAAACGGAAGATTCTCGTTACGTTGGTCT
TGTTTTCCCTCGTTTTCTTTTACGCTTACCTTATGGTGAAGAGAACCCTATTCGCTCATTTAACTACCGT
GAGGGCGTGACGGGTGAACAACACAATCGTTATTTGTGGGGTAACTCTGCTTTTGCTTTCGCCGCGAATA
TGACGCGCAGCTTTAAGAAAAATGGTTGGACAGTCAATATACGTGGTCCAGAGTCAGGCGGTAAACTGGA
TAAACTACCAATCCACTTCTATCAATCGGGGCGTGGAACAGAATCTAAAATTCCAACGGAAGTTCTGATT
TCAGAGACGAAAGAGCTGGAACTAGCAGACCATGGTTTTATTCCACTGAGTTACTACAAAAACAGTGACT
ATGCTTGTTTCTTCTCTGCGAACTCCACTCAACGCCCATTAGAGTGCGATGAGGATGCAGACACAGCGAA
CGCAAGAATCAACTCAAGATTACCTTATATTTTCTTGGTGTCTCGTATCGCTCAATACCTGAAAATTTTG
CAACGTGAAAACATTGGTTCATTAAAGTCGCGTCAAGATTTAGAGAACGAATTGAATGCGTGGTTGCAGA
GTCTTGTGACTAAAATGAACAACCCTGAACCAGAACTAGCGGCGACACACCCTCTAAAAGATGGACGTGT
GTTTGTTAGCGAGTCCGAAGACAACCCAGGCTATTACTTTGTGAACATGCACGTGCAACCGCACTTTCAA
GTTGAAGGTGTTGATGTGAAGCTTTCGCTTGTGTCTCAAATGCCAGAAGTTTAA