SecReT6
Protein ID: 326796899
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3671
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4054036..4054557 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDF2JVZ5
KEGG IDmme:Marme_3671
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-45, Aligned region: 6..159
Protein Sequence: 173 a.a.     [Download]
>gi|326796899|ref|YP_004314719.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MSDSFQSEIPRARVNIALDLDSGSGKKKKELPMKLLVMGDFSNGQSEGELSERERVNINGNNLEKVIANM
APKMEFAVPNRIKEGAGDIAVSLTAKRFDSFHPEQVAAQIPELSDLLSMRNLLKDLKSNLLDNATLRKEV
ERILNTQPDMDALKTELKALVEERSLETAEETQ
 
Nucleotide Sequence: 522 bp     [Download]
>ref|NC_015276.1|:c4054557-4054036 type VI secretion protein [Marinomonas mediterranea MMB-1]
ATGTCGGATAGTTTTCAAAGCGAAATACCTCGTGCTCGCGTTAATATCGCGCTTGATTTAGACAGCGGTA
GTGGCAAAAAGAAAAAGGAATTGCCAATGAAATTACTCGTTATGGGTGATTTCAGTAACGGACAATCTGA
AGGAGAATTGTCAGAGCGAGAGCGGGTTAACATCAATGGCAATAACCTAGAAAAGGTGATTGCGAATATG
GCTCCCAAAATGGAATTTGCGGTACCAAACAGAATAAAAGAAGGGGCAGGCGATATTGCCGTAAGCCTTA
CCGCAAAACGCTTTGATTCTTTCCACCCTGAGCAAGTTGCTGCCCAGATCCCTGAGCTAAGTGATCTTTT
GTCTATGCGAAACCTGCTAAAGGATCTCAAGTCAAACTTGTTAGACAACGCGACATTACGCAAAGAAGTC
GAACGCATTTTAAACACTCAACCCGATATGGATGCATTGAAAACGGAATTAAAAGCGTTGGTTGAAGAGC
GCTCTTTGGAAACTGCTGAGGAGACTCAATAA