SecReT6
Protein ID: 326796900
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3672
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4054614..4056176 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDF2JVZ6
KEGG IDmme:Marme_3672
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-12, Aligned region: 54..114
ImpA-rel_N [PF06812], Evalue: 1.30E-12, Aligned region: 429..453
Protein Sequence: 520 a.a.     [Download]
>gi|326796900|ref|YP_004314720.1| ImpA domain-containing protein [Marinomonas mediterranea MMB-1]
MSENITSEDSEVRSWAKQLCAPIEGHDSSSGQDPRYEDLFIELKAEVEKKQDVDYKKIADLAERVIAEIG
KDVRAAGYYLLAASKLEGIFGVYKGMLLLLTLLESYGETLFPLKEKARRMALTWPLQKKVLSFAQNNGDA
PSLVLIQNLQQVFETLCEQARKQTEDFGWPELSTWLSKTEKQLAEKESKSSGAPNTGKSAPASIEQSKTQ
NNAGQQSGNARQNSLHVEAISSDSQLAQVHRQLLKHYRGKQEYGAMVSLARAVKWGDLKLPTNENNKTRV
PAPRDASLNKIRVAYDSENWIEAFLAAEDAFMEPGGLFSFDLQRWSAVSAQKAGLKSVFMNIESMSHSLL
SRLPNLKKLSFENGVSFFSGSGAAWYEQVETKFKASSSNTEQVDYLAKARSIKEEKGLASSLSWLKQEQS
SEIAQQISVQLAQACLCHEEGLLDAALALLEALDKQTEETNVSVVLPHLAMGVWRQKYLVLKDTIAKASD
HEAMSRIEKERLRLQSRMCATDVALAVEWL
 
Nucleotide Sequence: 1563 bp     [Download]
>ref|NC_015276.1|:c4056176-4054614 ImpA domain-containing protein [Marinomonas mediterranea MMB-1]
GTGAGTGAAAATATCACTTCTGAAGACTCTGAGGTGAGATCTTGGGCTAAACAACTATGTGCGCCTATCG
AAGGTCATGACTCATCGTCAGGGCAAGATCCACGTTACGAGGATCTTTTTATCGAATTAAAGGCAGAAGT
AGAAAAGAAGCAAGATGTTGACTACAAAAAAATTGCAGATTTAGCGGAACGAGTTATCGCTGAAATCGGC
AAAGATGTTAGAGCCGCTGGGTATTATTTACTCGCAGCGAGCAAGCTTGAGGGCATATTTGGCGTATATA
AGGGCATGTTGTTACTTCTAACACTGCTTGAAAGCTATGGAGAGACGCTTTTCCCTTTGAAGGAGAAAGC
CCGACGTATGGCCTTGACCTGGCCTCTCCAAAAGAAGGTGTTGTCATTCGCGCAAAATAATGGCGATGCA
CCGTCGCTGGTGTTAATACAAAATTTACAGCAAGTATTCGAAACACTCTGTGAGCAGGCAAGAAAACAGA
CCGAAGATTTCGGGTGGCCTGAACTATCAACTTGGTTGTCAAAAACGGAAAAGCAGCTTGCTGAGAAAGA
AAGTAAGTCCAGCGGAGCGCCGAATACAGGAAAATCTGCTCCTGCTTCAATCGAGCAGAGTAAGACCCAG
AATAACGCTGGTCAGCAGTCGGGAAATGCAAGACAGAATAGTTTACATGTAGAGGCCATCAGTTCTGATT
CACAGCTTGCTCAAGTACATAGACAATTGCTTAAGCATTATCGTGGGAAGCAAGAGTACGGTGCGATGGT
GAGTCTTGCTCGAGCGGTTAAATGGGGAGACCTTAAATTACCGACGAATGAGAATAATAAAACACGTGTG
CCTGCGCCAAGGGATGCAAGCCTTAATAAAATTCGTGTGGCTTACGATAGCGAAAACTGGATAGAAGCAT
TTTTAGCGGCCGAAGATGCGTTTATGGAGCCGGGAGGCTTGTTCAGTTTCGACCTTCAGCGTTGGAGTGC
TGTGAGTGCGCAAAAAGCGGGTTTGAAATCTGTGTTTATGAATATCGAGTCAATGTCACATTCATTGCTA
AGTCGGTTACCAAATTTAAAAAAACTGAGCTTTGAAAATGGTGTGAGCTTTTTCTCTGGTTCGGGCGCGG
CTTGGTACGAGCAAGTTGAAACTAAGTTTAAAGCCAGCTCAAGCAATACCGAGCAAGTAGATTATTTAGC
GAAGGCGCGATCGATAAAGGAAGAAAAGGGATTGGCGTCGTCGCTTAGTTGGTTAAAGCAAGAGCAAAGT
TCAGAGATTGCACAACAGATCTCAGTACAACTTGCGCAGGCATGTTTATGTCATGAGGAAGGTCTATTAG
ACGCGGCGCTTGCGTTACTAGAGGCTCTCGATAAGCAAACAGAAGAGACGAATGTCTCCGTTGTGTTACC
CCATTTAGCGATGGGGGTATGGCGACAAAAGTATTTGGTTTTGAAAGATACGATTGCAAAGGCATCGGAT
CACGAGGCCATGTCGCGTATTGAAAAAGAGCGCTTGCGTTTACAGTCGCGTATGTGTGCGACGGACGTTG
CTCTGGCAGTAGAGTGGTTATGA