SecReT6
Protein ID: 326796903
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3675
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4061006..4061779 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF2JVZ9
KEGG IDmme:Marme_3675
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.50E-36, Aligned region: 53..234
Protein Sequence: 257 a.a.     [Download]
>gi|326796903|ref|YP_004314723.1| DotU family type IV / VI secretion system protein [Marinomonas mediterranea MMB-1]
MDNQLNILDATLVEGAAPIFSLVEARIASANSKGIEPNSTEVNLQMQDVGQEAGSAQDSISFRKSIEQAF
TDLERRAFEMEWVASMTRDVKFALAAYVDEAVMSSNLEEKLEWMSKPLCIEYFGESNAGEAFFTKLDRLR
EDLKDNQVTVSLYYVCLQLGYQGMYRIKGYERLQAYLATFRGQLDDTFSAAPRTLGEAAIPENKLIYKIG
TRQPYWVMLSVGGAVLVSMVLAYGAVMKYSLNESAHRMEQAEYVLAQ
 
Nucleotide Sequence: 774 bp     [Download]
>ref|NC_015276.1|:c4061779-4061006 DotU family type IV / VI secretion system protein [Marinomonas mediterranea MMB-1]
ATGGACAATCAATTAAATATTCTTGATGCGACGCTGGTTGAAGGCGCAGCACCGATTTTTAGTTTGGTCG
AAGCGCGGATCGCTAGCGCAAACAGCAAGGGAATCGAGCCAAATTCAACAGAGGTTAATCTGCAAATGCA
GGACGTTGGGCAAGAGGCCGGTTCAGCTCAAGACAGTATCAGTTTTCGGAAATCCATAGAGCAAGCGTTT
ACAGATTTAGAGCGGCGCGCGTTTGAAATGGAGTGGGTTGCCTCTATGACAAGAGACGTTAAGTTTGCTC
TTGCCGCGTATGTTGATGAAGCGGTTATGTCTTCTAATTTAGAAGAAAAATTAGAATGGATGAGCAAGCC
TCTTTGCATTGAGTATTTTGGTGAAAGTAATGCTGGGGAAGCTTTTTTCACCAAGTTAGATCGACTCAGA
GAAGATCTGAAAGATAATCAGGTCACCGTCAGTTTATATTATGTTTGTTTGCAATTGGGTTATCAGGGGA
TGTATCGAATCAAAGGATACGAACGTCTGCAAGCCTACTTAGCAACGTTTAGGGGGCAGCTAGATGATAC
GTTTTCCGCTGCGCCACGCACGTTAGGCGAAGCCGCAATACCAGAAAATAAGCTGATTTATAAAATCGGA
ACTCGGCAACCCTATTGGGTCATGCTGTCAGTAGGCGGTGCCGTTTTAGTCTCTATGGTGTTGGCGTACG
GCGCGGTTATGAAATATTCGCTTAATGAAAGCGCTCACAGAATGGAGCAGGCTGAGTACGTTTTAGCTCA
GTAG