SecReT6
Protein ID: 326796904
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3676
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4061784..4063121 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDF2JW00
KEGG IDmme:Marme_3676
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-93, Aligned region: 21..443
Protein Sequence: 445 a.a.     [Download]
>gi|326796904|ref|YP_004314724.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MGVQGLRKVVWAEGVFLGQQHFQAWDAYQEKIQSLRTKIYEPHFWGVKDVSWDKAALENGRLVLTQCLAV
LPNGQIIDYDRNRDTPVHLELGDLSRLELDVQLTIADSDNVDTITGYNAQGNAAWNSEYVDVADCFDSNR
KREVLLAQPNLNLIESGTQSNRVISLNIARLKKDMGGSYTLDSDYIPPLVSVHAASGLMNSLRSLTELLT
VRFKEINARRTNVSDVGSYTPSEMADFLFVSDISDILSELRIVEQNPSASSLQLYSTLCRAHDKLALHTQ
PDKVPYTQPYQHDNLSTTFSELYGAIRDIFGLSNVRMEASIQFNMKAPGLYESSVINSASLENCDFYLAV
YLERSDSSWVDQLPSLVKLSSPSDIQNLVASGMSGLPLQHIQRVPSKIRIKSGYEYFLIDKRSALWERVQ
STKKISGILFGEFADADVELIPIDE
 
Nucleotide Sequence: 1338 bp     [Download]
>ref|NC_015276.1|:c4063121-4061784 type VI secretion protein [Marinomonas mediterranea MMB-1]
ATGGGCGTTCAGGGTCTAAGGAAAGTCGTTTGGGCTGAAGGTGTCTTTTTGGGGCAGCAGCATTTTCAAG
CATGGGATGCTTACCAAGAAAAAATTCAGTCTCTCAGAACCAAAATTTACGAGCCTCACTTTTGGGGTGT
GAAAGATGTTAGCTGGGATAAAGCTGCTCTGGAGAATGGGCGTCTTGTTCTAACGCAGTGTTTAGCGGTT
CTGCCAAATGGCCAGATCATTGATTACGACCGAAATAGAGATACGCCAGTCCACCTAGAGTTAGGTGACC
TTTCCCGTCTTGAGCTTGATGTTCAGTTAACGATTGCCGACAGTGATAATGTTGACACTATTACTGGTTA
TAATGCGCAAGGCAATGCTGCTTGGAATTCCGAATATGTAGACGTCGCGGATTGTTTTGATAGCAATCGT
AAGCGGGAGGTTCTACTTGCTCAACCGAATTTGAATCTTATCGAAAGTGGTACCCAATCTAATCGCGTTA
TTTCTCTTAATATTGCTCGATTAAAAAAAGACATGGGTGGTAGTTATACCTTAGATTCTGACTACATCCC
ACCGTTGGTAAGTGTTCATGCCGCCAGTGGATTGATGAATTCGCTTCGCAGTTTGACTGAACTTTTGACG
GTACGTTTTAAAGAAATTAACGCTCGTCGTACCAATGTATCCGATGTTGGCAGTTACACGCCCTCAGAAA
TGGCAGACTTTTTGTTTGTGTCTGATATCAGTGACATACTCAGTGAATTGCGTATTGTTGAGCAAAATCC
AAGCGCTTCTTCGCTTCAGCTCTATTCTACCTTGTGTCGCGCGCATGATAAGTTAGCGTTACACACGCAG
CCAGATAAGGTGCCTTATACACAGCCTTATCAGCACGATAACCTTTCTACTACCTTCTCAGAGTTGTATG
GTGCGATTCGCGATATCTTCGGACTAAGCAATGTCCGAATGGAAGCGTCTATCCAGTTTAATATGAAAGC
ACCGGGCCTTTACGAGTCCTCTGTTATAAATTCAGCGAGTTTAGAAAATTGTGATTTCTATCTTGCTGTT
TATCTAGAACGTTCTGATTCTTCATGGGTAGACCAGTTACCCAGTTTGGTTAAATTGTCTTCTCCTTCCG
ATATACAAAACTTGGTGGCGAGTGGTATGTCGGGGCTGCCACTGCAGCACATTCAACGAGTTCCTTCCAA
GATACGTATTAAATCGGGCTATGAGTATTTTCTGATTGATAAGCGTAGTGCGCTTTGGGAGCGAGTTCAA
AGTACAAAAAAAATATCAGGGATTTTGTTCGGTGAGTTTGCGGATGCCGATGTTGAACTAATACCGATAG
ATGAGTAA