SecReT6
Protein ID: 326796905
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3677
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4063243..4063701 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF2JW01
KEGG IDmme:Marme_3677
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-25, Aligned region: 17..131
Protein Sequence: 152 a.a.     [Download]
>gi|326796905|ref|YP_004314725.1| type VI secretion lipoprotein [Marinomonas mediterranea MMB-1]
MLPIQICKSAVAILLVFTLFGCSTTRLSLDVNASSRLNPDAFGNVYSVIVRVYQLSDARLFEEASYDELW
KSSESALQDSVLSVEEYTISPDYHGELVFERLEAAKHVGVMAFFRSREGVWKVYDKIQSGLLSKTAKLEV
NIAGYDIEMVPR
 
Nucleotide Sequence: 459 bp     [Download]
>ref|NC_015276.1|:c4063701-4063243 type VI secretion lipoprotein [Marinomonas mediterranea MMB-1]
ATGCTCCCCATTCAAATCTGCAAATCTGCTGTCGCTATTTTATTGGTTTTTACTTTATTTGGCTGCTCTA
CTACCCGTTTGTCCTTAGATGTAAATGCTTCTAGTCGTTTAAATCCTGATGCCTTTGGTAATGTTTACTC
CGTCATTGTACGTGTCTACCAACTCAGTGATGCCCGACTGTTTGAAGAAGCGAGTTACGATGAACTTTGG
AAATCATCTGAGTCGGCGTTGCAAGACTCCGTTCTTTCAGTAGAAGAATATACGATTTCTCCCGACTACC
ACGGCGAGCTGGTTTTCGAACGGCTTGAAGCGGCTAAACACGTTGGGGTGATGGCGTTCTTTCGTTCAAG
AGAGGGTGTCTGGAAAGTATATGACAAAATTCAATCTGGCTTGCTTAGCAAGACCGCAAAACTCGAAGTG
AATATCGCAGGATATGATATTGAGATGGTGCCTCGTTAG