SecReT6
Protein ID: 326802193
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4835
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5750909..5752060 [-]
Producthypothetical protein
NoteTssK
UniProt IDF4C6B9
KEGG IDshg:Sph21_4835
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0013, Aligned region: 61..94
DUF876 [PF05936], Evalue: 0.0013, Aligned region: 167..222
Protein Sequence: 383 a.a.     [Download]
>gi|326802193|ref|YP_004320012.1| hypothetical protein [Sphingobacterium sp. 21]
MIKTIKYKPVNWVDGMRLSSEQFVANDKYYQDKMRDAISTRLNGYNYGILPCLDTNTRTFAVEITASAAQ
MVDIRVRSCHAITADGCRIHIDAGPDGRGNVGVSYYFNEISATGSNLYNVLLQVDPFERVPEGEINPDNE
PARHPYVGPSYKILVVPETNLSSEHIESRSLTVGRFALEQGSVVVNERYIPPCTSMMSHPLLIKYYELFS
TTVHKLQSTSFSILDKTVNDSSLTALARNLRMVTERILEYLAHHIFTFRYQLRQGTPLDFIGFFCHLSQT
LFTGMRCIATKEREDLLKYFYEWRDISPASFEELLARVMEMKYNHWDIYSAFALTEEFLVEITALWERLA
ALEYIGQHKENIVVAEQQQVQQMQTRKIWTLLD
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5752060-5750909 Sphingobacterium sp. 21 chromosome, complete genome
ATGATTAAAACGATTAAATATAAACCTGTCAACTGGGTAGACGGAATGCGCCTGTCTAGTGAACAATTTG
TTGCTAACGATAAATATTATCAGGATAAAATGCGGGATGCAATTTCGACCCGACTGAATGGCTACAACTA
TGGTATATTGCCTTGTCTAGACACGAATACCCGCACGTTTGCTGTAGAAATCACTGCAAGTGCCGCTCAA
ATGGTTGATATCCGGGTGCGTTCTTGCCATGCAATCACAGCGGACGGCTGTCGCATCCATATCGACGCCG
GACCGGATGGAAGGGGTAATGTAGGAGTCAGCTATTATTTTAATGAGATTTCGGCAACCGGTTCCAACCT
GTACAATGTGCTGTTGCAGGTTGATCCGTTTGAGCGGGTACCGGAGGGAGAAATAAACCCGGATAATGAG
CCTGCCCGTCATCCTTATGTAGGGCCGAGCTATAAGATTCTCGTTGTACCTGAAACGAACCTTTCGTCTG
AGCATATCGAGAGCAGAAGTTTAACCGTGGGCCGATTTGCCTTGGAGCAGGGCAGCGTTGTTGTTAATGA
ACGTTATATTCCGCCCTGTACCTCCATGATGAGCCACCCGCTCTTAATAAAGTACTATGAGCTTTTTTCG
ACAACCGTTCATAAGTTGCAGTCAACATCGTTCTCTATTTTAGACAAGACGGTGAACGATTCATCCCTAA
CGGCGTTAGCCAGAAACCTGCGTATGGTTACAGAAAGGATACTTGAATATTTGGCGCATCATATTTTCAC
TTTCCGCTACCAATTACGCCAAGGCACGCCTTTAGACTTTATTGGTTTTTTCTGTCATCTTAGTCAGACT
CTTTTCACGGGCATGCGGTGTATAGCGACCAAGGAGCGCGAGGATTTGCTCAAGTATTTTTATGAATGGC
GCGATATAAGTCCGGCAAGCTTTGAAGAACTGTTGGCCCGTGTTATGGAAATGAAATACAACCACTGGGA
TATTTACTCCGCCTTCGCTTTAACGGAAGAGTTTTTAGTAGAAATAACGGCACTATGGGAACGACTGGCG
GCGCTGGAATACATCGGCCAACATAAAGAAAATATTGTGGTGGCCGAACAGCAGCAGGTGCAGCAAATGC
AAACGCGGAAGATATGGACGCTATTGGACTAA