SecReT6
Protein ID: 326802194
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4836
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5752073..5752969 [-]
Producthypothetical protein
NoteTssN
UniProt IDF4C6C0
KEGG IDshg:Sph21_4836
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 298 a.a.     [Download]
>gi|326802194|ref|YP_004320013.1| hypothetical protein [Sphingobacterium sp. 21]
MDVQGFFIRYLLLPLFAIVAAILLVLKNKNQRFCSNKKLITILLLLGLFLGLPGLLGLLQLNYMPWGYTF
SVMYNFIVGSIVVYVLATRYEYELDTQKVYIGFFCLVAIMLGFYIHLLLFERFSTREMEFWAATSTCNFM
LPLFFWWSYRALLAVPAEIYKVWQYPQKPLQLELDALDFNRMLVLELEIFKSVTDREPIRVKVKAPAEMN
FGDWFYKFIEDYNLKFPNKPIRFNDQERRPFLWIFFIKNAFFKRNSFIDPDLNIRQNGITEKMTIYAKRV
SVNEAKMRAQDDDESIFI
 
Nucleotide Sequence: 897 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5752969-5752073 Sphingobacterium sp. 21 chromosome, complete genome
ATGGATGTTCAAGGATTTTTTATACGCTATCTACTGCTTCCACTCTTTGCGATTGTGGCGGCAATACTCC
TCGTGCTTAAAAATAAAAATCAACGATTCTGTAGCAATAAAAAACTTATTACCATTTTATTGCTTTTGGG
CTTATTCTTGGGATTACCCGGCCTGTTGGGGCTTTTACAATTGAACTATATGCCTTGGGGATACACCTTT
AGCGTCATGTATAATTTTATTGTCGGGAGCATCGTCGTGTACGTATTGGCAACACGCTACGAATATGAAC
TAGACACCCAAAAGGTATATATAGGTTTTTTTTGTCTGGTTGCCATTATGTTGGGATTCTATATCCATCT
GCTTCTATTCGAAAGGTTTTCTACTCGTGAGATGGAATTCTGGGCAGCAACTAGCACTTGCAATTTTATG
CTGCCACTTTTTTTTTGGTGGAGCTACCGAGCACTCCTGGCCGTTCCAGCTGAAATATATAAAGTATGGC
AGTACCCTCAAAAGCCCTTACAGTTGGAACTGGACGCTTTGGATTTTAACCGGATGCTCGTGCTGGAATT
GGAGATATTTAAATCGGTAACTGATCGAGAACCTATCCGCGTTAAAGTTAAGGCACCGGCGGAAATGAAT
TTTGGCGATTGGTTTTATAAGTTTATCGAAGATTACAATCTCAAATTTCCCAATAAGCCGATACGTTTCA
ACGATCAGGAGAGAAGACCTTTTCTTTGGATTTTCTTTATAAAAAACGCTTTCTTCAAACGGAATTCTTT
TATTGACCCGGATTTGAACATCCGACAGAACGGTATTACAGAAAAGATGACCATCTACGCGAAACGCGTT
TCTGTCAATGAAGCAAAGATGAGAGCCCAAGACGATGATGAATCCATTTTTATATAA