SecReT6
Protein ID: 326802195
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4837
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5753000..5753959 [-]
Producthypothetical protein
NoteTssG
UniProt IDF4C6C1
KEGG IDshg:Sph21_4837
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.60E-13, Aligned region: 172..314
Protein Sequence: 319 a.a.     [Download]
>gi|326802195|ref|YP_004320014.1| hypothetical protein [Sphingobacterium sp. 21]
MIPQIYTTHINSLTTDFKASSIIAAILEEGEMQDDLVEIVPSGPDRSVYAKEIKGVEHYYSETLMQDRVV
IKVNREGFYDMLPEGLFHRIPKYKDRMTKEEMIAHVRERREEEKFARQFFMPFEAALYHLRMLLDLYENR
LDKRSSYRDLAKLFVPLWPEFATLDNEQCIVWMHLIPYIPHKRNDLSFLESAIEALFNVRGKVICQTQCT
IKTEIPPAHQFALGNGYLGVDTIIGRHFMHQEDKVRILMGPAPIEKLLCFLPQQSNRRTLDTLCHYLLPI
DTAVELQLSYLPGDRVGSLGKDSKYALLGYTAHLSIDQD
 
Nucleotide Sequence: 960 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5753959-5753000 Sphingobacterium sp. 21 chromosome, complete genome
ATGATCCCTCAAATATATACGACTCACATAAACAGTTTGACAACAGATTTCAAGGCAAGCAGCATCATTG
CGGCCATACTGGAGGAAGGGGAGATGCAGGACGATCTGGTCGAAATTGTACCCTCCGGTCCTGATCGGAG
TGTTTATGCAAAGGAAATCAAAGGCGTGGAACACTACTATTCGGAAACGTTAATGCAAGATCGGGTAGTA
ATTAAAGTGAATCGTGAGGGTTTTTATGATATGCTACCGGAGGGACTATTTCATCGAATTCCGAAATACA
AAGATCGGATGACAAAAGAGGAGATGATAGCGCACGTACGGGAACGGAGAGAAGAAGAGAAGTTTGCACG
ACAATTTTTTATGCCTTTTGAAGCAGCACTTTACCATCTGCGTATGTTGCTTGATCTTTATGAAAATCGG
CTCGATAAGCGGTCTAGTTACAGAGATTTAGCAAAATTATTCGTGCCACTTTGGCCGGAATTTGCAACGC
TGGATAATGAACAATGTATTGTGTGGATGCATCTGATACCTTATATACCGCACAAACGAAATGATTTATC
CTTCTTGGAATCAGCTATTGAAGCGCTGTTTAATGTGCGTGGGAAAGTAATTTGTCAGACACAATGCACG
ATTAAAACGGAGATTCCACCTGCCCATCAATTCGCTTTGGGAAATGGCTATCTAGGTGTCGACACAATTA
TAGGACGTCATTTCATGCATCAGGAGGACAAAGTACGTATCCTCATGGGGCCAGCGCCAATAGAGAAATT
ATTATGCTTTTTGCCACAGCAATCGAATAGAAGGACGCTTGATACACTATGTCATTATTTACTGCCTATT
GATACAGCAGTGGAGCTTCAACTATCTTATTTACCCGGCGATCGGGTTGGTAGCTTGGGAAAGGATAGTA
AATATGCACTGTTGGGTTATACGGCCCATCTTTCTATTGATCAGGATTAA