SecReT6
Protein ID: 326802196
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4838
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5753956..5755818 [-]
Producthypothetical protein
NoteTssF
UniProt IDF4C6C2
KEGG IDshg:Sph21_4838
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 620 a.a.     [Download]
>gi|326802196|ref|YP_004320015.1| hypothetical protein [Sphingobacterium sp. 21]
MKELFYSSKDEIRNRVLKNARDHWGLKHVDDLDPMVRLFLEALCNEVFNISNEVKGLEQRIMDKLAKTLA
VETLTGALPAHAILHARPVELSALLDEKDSFTYHMRLPKGENGGQEGIDLSFSPLRPVYIAQASVRFMAT
GNNLFSIASDTRRSLMAQGQSGSYLAKNTVYIGIDWPVELTKLEGLTFYFDWPHFTVESSVIQLLALSKW
SIAEQTLQMEQDCFYVVNRKPNSTIAGLAVDSVIAEHIEAYYRNRFFSIARNQQLAPLRLEAFPECFEAV
FSVQDLPYLREPCLWIKIELPSAIPQQALDELFVSINAFPVVNRKLHELKHRLKAISDIIPMKTADYEQF
LNVEDLRDLPGNRYSEIPQGYDDNRNAGLYSVRYGGIERFDERSAGEMLEYLLEVLRDERAAFATYGTDF
LHSALTDLEQQISLISQRTDRNTSSMKGQVNYIVFKPLPKAEIMFLQYWTTNGAIANGLKTGSRLQTVDS
GKLNIDSIYLLSSTVGGRDRLNAVNRTRAYKYGLVTANRIVTQRDLETFCWLEFGDYIQDVRISRGLYDS
KNPEQGFIRTVDIIITPSTDAKLNEEEWRSILNLGLAKLRSRSVLTSHHRLFLSTGGVAV
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5755818-5753956 Sphingobacterium sp. 21 chromosome, complete genome
ATGAAAGAACTGTTTTATTCTTCGAAAGATGAGATTAGGAATCGTGTTTTGAAAAATGCTCGCGATCATT
GGGGATTAAAACACGTGGATGACCTTGATCCGATGGTGAGATTATTTTTGGAGGCGCTGTGCAACGAAGT
CTTTAACATATCAAATGAGGTAAAGGGCTTGGAACAGCGAATAATGGATAAGCTTGCTAAGACGTTGGCT
GTAGAGACACTTACCGGTGCGCTTCCTGCACATGCGATTCTTCATGCCCGGCCTGTAGAGTTGAGTGCCT
TGTTGGATGAAAAAGACAGCTTTACCTATCATATGCGTCTTCCTAAAGGAGAGAATGGGGGGCAAGAGGG
TATAGATTTGTCTTTCAGTCCGTTAAGGCCTGTTTATATAGCACAAGCTTCGGTACGTTTCATGGCGACG
GGCAACAATTTGTTTAGCATAGCTTCTGATACCAGGCGGTCGTTGATGGCACAGGGGCAGTCAGGTTCTT
ATCTGGCAAAAAATACCGTGTATATAGGTATTGATTGGCCTGTTGAGCTTACTAAGCTCGAGGGACTCAC
TTTTTATTTCGATTGGCCGCATTTCACTGTAGAAAGTTCAGTTATACAATTACTGGCACTTTCCAAGTGG
AGTATTGCTGAACAAACCCTACAAATGGAGCAGGATTGTTTTTACGTTGTAAACCGCAAACCAAATTCGA
CAATTGCAGGCCTAGCAGTCGATTCGGTAATAGCAGAGCATATAGAGGCATATTACAGAAATCGTTTTTT
TTCGATTGCACGAAACCAACAGTTGGCACCACTCCGTTTGGAAGCTTTTCCGGAATGCTTTGAAGCGGTC
TTTTCGGTGCAAGATTTGCCGTATTTGCGTGAGCCCTGTTTGTGGATTAAGATTGAACTACCCTCGGCTA
TTCCTCAACAGGCTTTGGATGAGCTTTTTGTAAGCATTAATGCTTTTCCGGTGGTAAATAGAAAGTTGCA
TGAGCTGAAACATCGATTGAAGGCAATTAGTGATATAATTCCAATGAAGACGGCCGATTATGAACAGTTT
TTAAATGTGGAGGACTTGCGTGATCTGCCCGGTAATCGTTATAGCGAAATTCCTCAAGGGTATGATGATA
ACCGAAATGCTGGCCTTTATTCCGTCCGCTACGGCGGCATCGAACGTTTCGATGAGCGGAGCGCAGGGGA
AATGCTTGAGTATCTGTTAGAGGTATTGAGAGACGAAAGAGCTGCTTTCGCAACTTATGGTACCGATTTT
CTGCATTCAGCTTTAACGGATTTGGAGCAACAAATTTCGTTGATTTCACAACGTACCGATAGGAATACCT
CTTCAATGAAGGGACAGGTAAATTATATTGTTTTTAAACCGCTGCCAAAGGCTGAGATTATGTTTTTACA
ATATTGGACTACGAATGGTGCTATTGCAAACGGCCTAAAAACAGGAAGCCGTTTGCAGACCGTCGATAGC
GGTAAACTGAACATCGATAGTATTTATTTATTGAGCAGTACGGTTGGTGGTAGGGACCGTCTCAATGCTG
TTAATCGAACCCGAGCGTATAAATATGGATTGGTAACCGCCAATCGTATTGTTACCCAGCGCGATCTGGA
AACTTTTTGCTGGCTTGAATTCGGTGATTATATTCAAGATGTCCGTATCAGTAGAGGGTTATATGATAGC
AAAAATCCCGAGCAGGGTTTTATACGGACCGTGGATATTATCATCACACCTTCAACAGACGCGAAGCTTA
ACGAAGAGGAGTGGCGGTCCATATTAAACCTTGGCCTTGCGAAGTTGAGAAGCCGAAGCGTCTTGACATC
ACATCATCGGCTATTTCTATCCACGGGAGGGGTGGCTGTATGA