SecReT6
Protein ID: 326802197
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4839
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5755815..5756264 [-]
ProductgpW/GP25 family protein
NoteTssE
UniProt IDF4C6C3
KEGG IDshg:Sph21_4839
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-11, Aligned region: 28..115
Protein Sequence: 149 a.a.     [Download]
>gi|326802197|ref|YP_004320016.1| gpW/GP25 family protein [Sphingobacterium sp. 21]
MQGFRYKKPLSFKRLVAGKGLETTDVGYSVSQHIELLIFTHFGEHRFNRQYGCSIWELDFELIISDWKWE
EKFKQSLLTAIRLEEPRIYNVDVQVDLSEAARASFGSGVTEVKKRVSIYVKGLIVETGEAYQFSTDLFLG
PLSGKENKV
 
Nucleotide Sequence: 450 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5756264-5755815 Sphingobacterium sp. 21 chromosome, complete genome
ATGCAAGGTTTTCGATATAAGAAACCGTTATCCTTTAAAAGGTTGGTAGCCGGAAAGGGACTGGAAACCA
CCGATGTTGGTTATTCTGTGTCACAACATATTGAGTTGCTTATTTTTACCCATTTCGGTGAACATCGTTT
TAATCGGCAATATGGTTGTTCAATATGGGAACTCGATTTCGAACTCATTATCAGTGATTGGAAATGGGAG
GAGAAGTTTAAACAATCACTGTTGACCGCCATACGTCTGGAGGAGCCACGGATCTATAATGTAGACGTAC
AGGTTGACCTAAGTGAGGCAGCGCGCGCTTCTTTTGGAAGCGGTGTTACGGAAGTGAAAAAGAGGGTAAG
CATCTACGTAAAGGGACTTATTGTTGAAACAGGTGAAGCTTATCAATTTTCCACAGATCTATTTTTAGGA
CCATTATCCGGTAAGGAGAACAAAGTATGA