SecReT6
Protein ID: 326802199
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4841
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5756850..5758232 [-]
Producthypothetical protein
NoteTssC
UniProt IDF4C6C5
KEGG IDshg:Sph21_4841
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-20, Aligned region: 74..115
DUF877 [PF05943], Evalue: 4.70E-20, Aligned region: 112..249
DUF877 [PF05943], Evalue: 4.70E-20, Aligned region: 291..440
Protein Sequence: 460 a.a.     [Download]
>gi|326802199|ref|YP_004320018.1| hypothetical protein [Sphingobacterium sp. 21]
MEPLKEQNKGTAERTYSPGDSSKGAVPPLAESLEKLVKVGGIDLLEASIDGLQNLNPTRKARKQIFLTGS
EKKKERQELKKKIELWLEILENADSVAAMMDRSRQKLEEAEASLQRNLAIALEASRALEQAYRSVHLFYQ
NTEADKLKNVVLLNASLEQLKDLDNPRFIDYVSTELKQNYDRLDLRDNYSLLVVPGYLGSNKIIERWAKI
AHENKAMLVTDFADLDHPDDVIDLFGEANLTGGDVYRSNVIMTCNWLIGRGKVEEVGEQNDLTVPGSAAL
AGKIYHTLMSQVTAGKKHGSLNEVDGVRFNLKKSEISILERLGLVPMVNEYGKVMAFSAKTLFNGDNIGL
QTYSVVRVFDYITKVLFDFLNRRAFENWNSKTERDLRSQIVKFLDRIQGPDRLIEHFKIMRFERDEVQKD
TIHLDIHITPYFPAKSFVVKLDGYKGENEETTWSSEYAQQ
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5758232-5756850 Sphingobacterium sp. 21 chromosome, complete genome
ATGGAACCTTTAAAGGAGCAAAATAAGGGAACGGCCGAAAGGACCTATTCTCCTGGTGATAGCAGTAAGG
GTGCAGTACCGCCACTGGCAGAAAGTTTGGAAAAGCTGGTGAAAGTCGGAGGTATAGATCTGCTGGAAGC
ATCGATTGATGGACTTCAGAACCTGAATCCAACACGTAAAGCACGAAAGCAGATATTTTTGACAGGAAGC
GAAAAAAAGAAGGAACGGCAGGAGCTGAAAAAGAAGATAGAACTCTGGTTGGAGATCTTAGAAAACGCTG
ACTCTGTTGCTGCTATGATGGATCGTAGCCGTCAGAAACTGGAGGAGGCGGAAGCGAGTCTTCAGCGAAA
TTTAGCGATAGCTTTAGAGGCCTCTCGTGCGTTGGAGCAGGCATATCGGTCAGTGCACCTTTTTTATCAG
AATACGGAGGCAGACAAGTTGAAGAATGTTGTTTTATTGAACGCTTCGCTTGAGCAGTTGAAAGATTTAG
ATAACCCTCGATTCATTGATTATGTAAGTACTGAACTGAAGCAAAACTACGATCGTTTGGATCTTCGCGA
TAATTATTCATTACTGGTGGTACCAGGTTATTTGGGATCGAATAAGATTATTGAGCGTTGGGCAAAAATC
GCGCACGAAAATAAAGCCATGCTGGTTACCGACTTTGCTGACCTCGATCACCCTGATGACGTGATCGACC
TCTTCGGTGAAGCTAATCTTACGGGTGGAGATGTATACCGTTCAAACGTGATCATGACTTGTAACTGGTT
AATTGGACGTGGTAAGGTTGAAGAGGTGGGCGAGCAGAACGATCTGACAGTACCCGGATCTGCGGCTTTA
GCGGGAAAAATTTATCACACCCTTATGTCACAGGTAACAGCCGGTAAAAAGCACGGATCACTGAACGAAG
TGGATGGGGTACGCTTCAACCTGAAGAAAAGTGAAATCTCCATCCTCGAACGTTTGGGGCTTGTCCCCAT
GGTTAATGAATATGGGAAAGTGATGGCCTTTTCTGCTAAAACACTATTTAACGGTGATAATATTGGCTTA
CAGACGTACTCTGTGGTCCGAGTTTTCGACTACATCACCAAAGTACTTTTTGACTTCCTCAATAGAAGGG
CTTTCGAAAACTGGAACTCTAAAACCGAACGAGATCTCCGTAGTCAGATTGTTAAATTTCTTGATCGTAT
ACAAGGGCCTGATCGCCTTATTGAGCATTTTAAGATCATGCGGTTCGAGCGGGATGAAGTGCAAAAAGAT
ACGATCCATTTAGATATTCATATAACGCCTTATTTTCCGGCGAAAAGCTTTGTGGTAAAGCTAGACGGGT
ATAAAGGCGAGAATGAAGAAACAACTTGGAGCTCTGAATATGCGCAGCAATAA