SecReT6
Protein ID: 326802200
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4842
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5758249..5758695 [-]
Producthypothetical protein
NoteTssB
UniProt IDF4C6C6
KEGG IDshg:Sph21_4842
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 0.01, Aligned region: 48..132
Protein Sequence: 148 a.a.     [Download]
>gi|326802200|ref|YP_004320019.1| hypothetical protein [Sphingobacterium sp. 21]
MFNYEIGGNERKIDASEAFADIAHNKTLFVQKLTDSDPIKPEKVEGLKTVQDVFNHYEPQVQVEFENQDG
TLIPETLRFANLGDFAAQSMIKQSRHLNNVQIEKEMSISVLKQLKSNRTLQTTLANEETKNAFVNALKSF
IRELEEND
 
Nucleotide Sequence: 447 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5758695-5758249 Sphingobacterium sp. 21 chromosome, complete genome
ATGTTTAATTACGAAATCGGCGGAAATGAACGCAAGATAGACGCTTCGGAGGCATTTGCAGATATAGCGC
ACAATAAGACTTTGTTTGTACAGAAGCTTACAGATAGTGATCCGATAAAACCGGAAAAGGTGGAAGGATT
AAAAACGGTGCAAGATGTATTCAACCATTATGAACCGCAGGTTCAGGTTGAATTTGAAAACCAAGACGGA
ACGCTGATTCCAGAGACACTTCGTTTCGCCAATTTAGGTGATTTTGCAGCGCAAAGTATGATTAAACAAA
GTCGACACTTAAATAATGTACAGATCGAAAAAGAGATGTCTATTAGTGTTCTTAAGCAACTCAAGTCGAA
TAGAACCTTGCAGACTACATTAGCGAACGAGGAGACTAAAAACGCATTTGTCAATGCGCTCAAAAGCTTT
ATACGCGAATTAGAAGAAAACGATTAA