SecReT6
Protein ID: 326802203
SecReT6 ID917
T6SS typeiii
Gene symbol-
Locus tagSph21_4845
StrainSphingobacterium sp. 21
Repliconchromosome [GenBank: NC_015277] [Browse all T6SS(s) in this replicon]
Location [Strand]5763615..5764571 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDF4C6C9
KEGG IDshg:Sph21_4845
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 1.30E-15, Aligned region: 51..109
PKD [PF00801], Evalue: 1.30E-15, Aligned region: 135..187
Protein Sequence: 318 a.a.     [Download]
>gi|326802203|ref|YP_004320022.1| PKD domain-containing protein [Sphingobacterium sp. 21]
MTTLTRSNTQAEGRGTLHYLFLYFMLAIILLVCIIMLLRNYFFYERKVNATVLKNELYLNEKLLFTDNTE
GAENWLWEFGNGQHSERQNGSYQYTAAGSYIVRLTVDNQLRVQFPVVVKDTVAGIRDTALTVNGPTSGIV
NEEIRLEAVGAGTQFEWSFGETGRIDVKGRSALYRFHNPGKYLVQLRSDRSRPVNHLMHITDPSLDTVLV
VPGEGEKVIVDDIRARLQAIADGADFNTNYYYLVRRYLCGNEKVSVSIEQDNLKRTDDFYSYCMGLTFSQ
EIYVDQAQLVTSPNAACATLLSIKQHTSEKIRARLKSE
 
Nucleotide Sequence: 957 bp     [Download]
>gi|326797444|ref|NC_015277.1|:c5764571-5763615 Sphingobacterium sp. 21 chromosome, complete genome
ATGACGACTTTGACGCGATCGAATACGCAAGCGGAAGGGCGAGGTACGCTTCACTATCTGTTCTTATATT
TCATGCTGGCTATTATTCTGCTGGTTTGCATTATTATGCTCCTTAGAAACTATTTTTTCTATGAACGTAA
AGTTAATGCCACAGTTCTGAAGAATGAGCTTTATCTGAATGAAAAATTGCTATTTACGGATAATACCGAA
GGTGCGGAAAATTGGCTATGGGAATTCGGAAATGGTCAGCATTCGGAGCGGCAAAATGGAAGTTACCAAT
ATACGGCCGCCGGTTCCTATATCGTTCGGTTAACCGTTGATAATCAATTGCGTGTTCAGTTTCCGGTAGT
GGTGAAAGACACCGTGGCAGGTATACGGGATACTGCTCTGACGGTTAACGGTCCGACGTCAGGTATAGTA
AATGAAGAAATCAGGTTGGAGGCTGTGGGTGCCGGAACGCAGTTCGAATGGTCCTTCGGTGAAACTGGGA
GGATAGACGTGAAAGGACGCTCCGCTCTATATCGTTTTCATAATCCGGGAAAGTACCTGGTTCAACTTCG
AAGTGATCGAAGCCGACCGGTAAATCACTTGATGCATATCACTGATCCGAGTTTGGACACGGTATTGGTG
GTTCCAGGTGAAGGTGAGAAGGTGATCGTTGACGACATCAGGGCGCGTTTACAAGCCATTGCCGATGGCG
CTGATTTTAATACGAACTATTATTATCTCGTACGCCGCTATCTATGTGGAAATGAAAAAGTCAGCGTCTC
GATCGAGCAAGATAACCTTAAAAGGACAGATGATTTTTACTCTTATTGCATGGGGCTTACCTTTTCGCAA
GAGATTTACGTCGATCAAGCGCAGCTTGTGACGAGTCCGAATGCCGCATGCGCCACGCTCCTGAGCATCA
AACAGCATACTTCGGAGAAAATACGGGCCAGGTTAAAGTCAGAATAA