SecReT6
Protein ID: 329805031
SecReT6 ID789
T6SS typei3
Gene symbol-
Locus tag329805031
StrainSalmonella enterica GIFU10007
Repliconchromosome [GenBank: JF766712] [Browse all T6SS(s) in this replicon]
Location [Strand]37794..38426 [+]
Producthypothetical protein
NoteTssA
UniProt IDF5CQ94, F5CQ94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|329805031|ref|AEC05343.1| hypothetical protein [Salmonella enterica]
MADIRGITLSNSAALHLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQV
WARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPAPAPAGTVMDNAIPARAEDVPPVNAPPGIS
IPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|329805030|gb|JF766712|:37794-38426
ATGGCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCACCTGCAGGTACGGGACGTGGAGC
GCGCGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCAGACCT
CGAAGCCCGTGGGGCATTACCGCTAGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTG
TGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGC
CTGACGTGGTACAGACAACCACGCCGGAAATCCCTCCGTCGCCAGCGCCAGCGCCAGCTCCCGCAGGCAC
GGTTATGGATAATGCCATTCCTGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCT
ATCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTC
GTCGCTGGTTTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTATTACGTCAGGCTGAAAGACTGGT
GGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAG
TGA